KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2279Help
Entry
Oant_2279         CDS       T00568                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00970  Aminoacyl-tRNA biosynthesis
oan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Oant_2279
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oan03029]
    Oant_2279
Enzymes [BR:oan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Oant_2279
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Oant_2279
Mitochondrial biogenesis [BR:oan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Oant_2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABS14995
UniProt: A6X191
LinkDB All DBs
Position
1:complement(2405662..2407164)
Genome map
AA seq 500 aa AA seqDB search
MSLIDTRIPEPKRFISGATGDWEVVIGMEVHAQVTSESKLFSGASTSFGAEPNSNVSLVD
AAMPGMLPVINLECVKQAVRTGIGLNAQINLKSVFDRKNYFYPDLPQGYQISQFKQPIVG
EGKIMISVGPDNKGQFEDVEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS
KPDLRSSDEARAYLTKLRTIVRYLGTCDGNMDEGSMRADVNVSVRRPGGEFGTRCEIKNV
NSIRFVGQAIEYEARRQIAILEDGGSIDQETRLFDPVKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAFVDALAVDLPELPDVKKQRLVEKQGISIYDASILVTEKAIADYYESVAAGR
DGKAAANWVINDLLGALNKAGKDIEESPVSPEQLGAVIDLIKEGTISGKIAKDLFEIVWN
EGGDPKKLVEERGMKQVTDTGAIEKAVDDVIAANPEKVEQAKAKPTLAGWFVGQVMKATG
GKANPQSVNELVKAKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaatcgatacgcgtatacctgaacccaaacgctttatctccggcgcgaccggc
gactgggaagtcgtcatcggcatggaagtccatgcgcaggtcacgtcagaatcgaagctg
ttctccggcgcttccacttcgtttggcgcggagccgaattcgaatgtttctctggttgat
gcagccatgccgggcatgctgccggtcatcaatctggaatgcgtcaagcaggcggttcgc
acgggaatcgggctcaatgctcagatcaatctgaagtcggttttcgaccgcaagaactat
ttctatcccgatctgccgcagggctaccagatctcgcagttcaagcagcctatcgttggc
gaaggcaagatcatgatttcggtcggtccggacaataagggccagttcgaagacgtggaa
atcggcatcgagcgcctgcatctggaacaggatgcgggcaagtccatgcacgaccagcat
ccgaccatgtcctatgtggacctgaaccgttctggtgtggcgttgatggaaatcgtatcg
aagccggacctgcgttcctccgatgaagcacgcgcttatctgaccaagctgcgcacgatt
gtgcgttatctcggcacttgcgacggcaatatggacgaaggctcgatgcgcgctgacgta
aacgtctccgtgcgccgtccgggcggggaattcggcacgcgctgcgaaatcaagaacgtc
aactcgatccgcttcgtcggtcaggcgattgaatatgaggctcgtcgccagattgctatt
ctcgaggacggtggctccatcgatcaggaaacgcgtctgttcgatccggtaaagggtgaa
acccggtccatgcgctccaaggaagaagcgcatgactatcgctatttccctgatccggac
cttctgccactcgagttcgaccaggcattcgtggatgcgctggcagtggatctgccggaa
ctgccggacgtcaagaagcagcgcctcgtcgagaagcagggcatctcgatctatgatgca
tcgattctcgttaccgagaaggccattgctgattattatgaatccgttgctgcgggtcgt
gacggcaaggccgcagcgaactgggtcatcaacgatctcctcggcgcgctgaacaaggcg
ggcaaggacattgaggaatcgccggtcagcccggaacagctcggtgcagtcatcgatctc
atcaaggaaggtacgatttccggtaagatcgccaaggatcttttcgagatcgtctggaat
gagggcggtgacccgaagaagctcgttgaagaacgtggcatgaagcaggttacggacacc
ggtgccatcgagaaggccgtggacgatgtcattgctgccaacccggaaaaggttgagcag
gcgaaagccaagccgacgctggctggctggttcgttggtcaggtcatgaaggcaacgggc
gggaaggccaacccgcaatccgtgaatgaactggtcaaggccaagctcgggattgaagag
taa

DBGET integrated database retrieval system