KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3067Help
Entry
Oant_3067         CDS       T00568                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00630  Glyoxylate and dicarboxylate metabolism
oan01100  Metabolic pathways
oan01120  Microbial metabolism in diverse environments
oan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Oant_3067
Enzymes [BR:oan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Oant_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABS15775
UniProt: A6X3H1
LinkDB All DBs
Position
2:complement(379885..381141)
Genome map
AA seq 418 aa AA seqDB search
MNICLTYRIETTGGIEQMAAKIASDQSTGTFVAVPGETEELKARVAARVLEIRPLEDAMV
PAWPELEPGHSPIRRADVDIAFPLDAIGTDLAALMTIAVGGVYSIKGMTGIRVVDMKLPE
AFKNAHPGPQFGIAGSRRLTGVEKRPIIGTIVKPALGLRPHETAELVGELIESGVDFIKD
DEKLMSPAYSPLKERIAAIMPRILDHEQKTGKKVMYAFGISHADPDEMMRNHDMVLEAGG
NCAVVNINSVGFGGMSFLRKRSGLVLHAHRNGWDILTRNPGAGMDFRVYQQFWRLLGVDQ
FQINGIRVKYWEPDESFVNSFKAVSTPLFDPSDCPLPVAGSGQWGGQAPETYERTGRTTD
LLYLCGGGIVSHPGGPAAGVRAVQQAWEAAVAGIPLETYAADHPELAASLAKFGKGDE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctgcttgacctatcgcattgagacaaccggcggcatcgaacagatggcggcc
aagatcgcgagcgatcagtcgaccggcactttcgtcgccgttccgggtgagacggaagaa
ctgaaggcgcgggttgcagcacgtgtgctcgagattcgcccgcttgaagacgcaatggtg
cctgcatggccggagcttgagcccggacacagcccgatcaggcgcgccgatgtcgatatt
gcttttccgctcgatgcaatcggtaccgatcttgcagcactgatgacgattgccgttggc
ggcgtctattcgatcaagggcatgacaggcatccgcgttgtcgacatgaagctgccggaa
gccttcaaaaacgcgcatcccggcccacagttcggcattgccggaagccgtcgtctgaca
ggcgttgaaaagcgtccgatcatcggcaccatcgtcaagcccgcgctcgggctgcgtcca
catgagacggcagaactcgtcggtgaactcattgagtcaggcgtcgatttcatcaaggac
gatgaaaaactgatgagcccggcctactcgccgcttaaagagcgcatcgccgcgatcatg
ccgcgtattctcgatcacgaacagaagaccggcaagaaggtcatgtatgccttcggcatc
tcccatgctgatcctgacgagatgatgcgcaatcatgacatggtgctcgaggctggcggc
aattgcgctgtggtcaacatcaactcggtcggctttggcggcatgagcttcctgcgcaag
cgctcgggcctcgtgcttcatgcccatcgcaatggctgggatattctgacccgcaatccg
ggcgctggtatggatttccgcgtctatcagcagttctggcgtctgctcggtgtcgatcag
ttccagatcaacggtattcgcgtgaagtattgggagccggacgaaagtttcgtcaattcg
ttcaaggccgtcagcacgcccctgtttgatccgtccgattgtccgcttcctgtagccggt
tccgggcaatggggtggacaggcacctgaaacctatgagcgcacgggccgcacgacggac
ctgctttatctgtgcggcggcggcattgtcagccatccgggtggcccggctgccggtgtt
cgcgccgtacagcaggcatgggaagcagcagttgcgggtattccgcttgaaacttacgcc
gcagatcaccccgaacttgcagcttcgctcgcgaaattcgggaaaggtgacgagtaa

DBGET integrated database retrieval system