KEGG   Olleya aquimaris: DZC78_07260Help
Entry
DZC78_07260       CDS       T05582                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oaq  Olleya aquimaris
Pathway
oaq00010  Glycolysis / Gluconeogenesis
oaq00020  Citrate cycle (TCA cycle)
oaq00620  Pyruvate metabolism
oaq01100  Metabolic pathways
oaq01110  Biosynthesis of secondary metabolites
oaq01120  Microbial metabolism in diverse environments
oaq01130  Biosynthesis of antibiotics
oaq01200  Carbon metabolism
Module
oaq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DZC78_07260
   00020 Citrate cycle (TCA cycle)
    DZC78_07260
   00620 Pyruvate metabolism
    DZC78_07260
Enzymes [BR:oaq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DZC78_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AXO80200
LinkDB All DBs
Position
complement(1544633..1546255)
Genome map
AA seq 540 aa AA seqDB search
MAEIINMPRLSDTMEEGTVAAWLKKVGDKIEEGDILAEIETDKATMEFESFHEGTLLHIG
VQEGETTEVDKLLAIIGEEGEDISGLLDGSTKEASADATETSSDESASNDDTSEASTSQE
IPEGVTVVTMPRLSDTMEEGTVASWLKNVGDVVEEGDILAEIETDKATMEFESFQSGTLL
YVGLNEGDSAKVDSLLAIIGPEGTDVADIAKNFTVGDEAPKKEDAPKQDAKVEAPKQDTK
TESAPKAETTTNTTGRIFASPLAKKMAEEKGINLSQVNGSGENGRIVKRDIENFSPVGST
QSSAPVAKFVATGQEDFDEKPNSQMRKAIAKNLAKSKFTAPHYYLNVEFDMDNAMAFRAQ
YNSIPDTKISFNDMIVKACALALRQHPQVNSQWFDDKMKLNNHVHIGVAVAVEDGLLVPV
VKFANEQSLPQIGAAVRDFAGRARKKKLSLDEMEGSTFTISNLGMFGIESFTSIINQPNS
AILSVGAIVQKPVVKNGQVVPGNTMKLTLACDHRTVDGATGAQFLQTLKGFIENPVTMLV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattataaatatgccacgtcttagtgacaccatggaagaagggactgttgct
gcttggttaaaaaaagttggagataaaattgaagaaggtgatatcctagctgaaattgaa
actgataaagcaaccatggaatttgagtcttttcacgaagggactttacttcatattggt
gtacaagaaggagaaactactgaggtagataaacttttagctattattggtgaagagggt
gaagatatttctggtttattagacggaagtactaaagaagcttctgcagatgcaactgaa
acatcaagtgatgaatctgcatccaatgatgatacgtcggaagcatcaacttctcaagag
attcctgaaggagtaactgttgttactatgccaaggttaagtgatactatggaagaaggt
acagttgcctcatggttaaaaaatgttggagatgtagttgaagaaggtgacatccttgca
gagattgaaacagataaagcaaccatggagtttgaatcttttcaatcaggtactttatta
tacgtaggtttaaacgaaggtgattctgccaaagtagattcattattagcaattattgga
ccagaaggtactgatgttgctgacatagctaaaaactttactgttggtgatgaagcacct
aaaaaggaagatgctccaaaacaagacgctaaagtagaagctcctaaacaagacactaaa
acagaatctgctcctaaagcagagactactacaaatacaacaggacgtatttttgcttct
ccattagctaaaaaaatggcggaagaaaaaggaattaatttatctcaagttaatggttct
ggagaaaatggacgtattgttaaacgtgatatagaaaacttctctccagttggatctaca
caatcctctgctccagtagctaaatttgttgctacaggtcaagaagattttgacgaaaaa
ccaaactcgcaaatgcgtaaagctattgctaaaaacttagctaaatctaaatttacagca
cctcattattatttaaatgtggagtttgatatggataacgctatggcatttagagcgcaa
tataactctattccagatactaaaatttcatttaacgatatgattgttaaagcctgtgct
ttggcattacgtcaacatcctcaagttaactctcagtggtttgatgataaaatgaaatta
aacaatcacgtacatattggtgtagcagtagctgtagaagacggtttattagtcccagtt
gttaagtttgctaatgagcagtctttacctcaaattggtgcagctgtaagagattttgct
ggtcgtgctagaaaaaagaaattatctttagatgagatggaaggtagtacatttactatc
tctaacttaggtatgtttggtatagaaagttttacttctataataaatcaacctaactct
gcgatactttcggttggagcaattgttcaaaaacctgtagtaaaaaacggtcaagttgta
ccaggtaatactatgaagttaaccttagcttgtgatcacagaacagtggatggagctaca
ggagcacaatttttacaaacattaaaaggttttattgaaaacccagtgacgatgctagta
taa

DBGET integrated database retrieval system