KEGG   Olleya aquimaris: DZC78_12710Help
Entry
DZC78_12710       CDS       T05582                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oaq  Olleya aquimaris
Pathway
oaq00620  Pyruvate metabolism
oaq00680  Methane metabolism
oaq01100  Metabolic pathways
oaq01120  Microbial metabolism in diverse environments
oaq01200  Carbon metabolism
Module
oaq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:oaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DZC78_12710
  09102 Energy metabolism
   00680 Methane metabolism
    DZC78_12710
Enzymes [BR:oaq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DZC78_12710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Pox_RNA_pol_35 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: AXO81212
LinkDB All DBs
Position
2791276..2793855
Genome map
AA seq 859 aa AA seqDB search
MSLQPKLTRFNQNVLSKYQIYNGIFMTLPFDTITKTGVLLPLFHETCKTGFENGDNPTII
VDTFFKKYQARRSDKSKIDLLFRFIQYIERQVVLFDAIEDAAFPVVNNMDGIGTLRSLKE
SATADGKLDKLREYLEEFKVRIVLTAHPTQFYPGTVLGIITDLTEAVKQNDLLRINDLLA
QLGKTPFFKHEKPTPYDEAVSLIWYLENVFYESFGKIYDYIQQNIFDGQPIDNNIINVGF
WPGGDRDGNPFVTPKITVKVAKRLHETIIKNYYKDIRKLKRKLTFQGIESRISKIETELY
KKVLHEESSLTLEAFVSELKDIRQVVIDQHQSLYVTEITSLLNKLHLFGFHFSSLDIRQD
SRAHHKVFTDMVDVMIANGSKDIPNNYHDLSETEQVKILSEVKGKVDLSLIKDENTLKAL
NTIKAIKTIQETNGEQAANRYIISNNQTTLNVMQLFAMLKLVAFHDELTIDVGPLFETIT
DLENAHLVMEELYTNPAYAKHLKARGNKQTIMLGFSDGTKDGGYLMANWAIYKAKERLTA
ISRKYDVTVIFFDGRGGPPARGGGKTHNFYASLGPTIEDKEVQLTIQGQTISSNFGTLDS
SQYNLEQLISSGIYNSLSDADLSMVPENRVVMDNLAKLSYQTYVDFKNHPKFISYLEHMS
TLKYYAKTNIGSRPSKRGKSEGLVFDDLRAIPFVGSWSQLKQNVPGFFGVGTALKHYEDA
GEFEKAQRLFKTSSFFRTLIENSMMSLSKSFFDLTKYMSEDPEYGEFWNVIHTEYLTTKR
LILKLTGYTELMEEEPSGKASIKVRESIVLPLLTIQQFALKQIQELEKVEEKDVDLIAVY
EKLVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacaacctaaattaacacgtttcaatcaaaatgtactctctaaatatcagatt
tacaatggtatttttatgacacttccttttgatactattacaaaaacaggtgtgttactt
ccgttgtttcatgaaacctgtaaaactggatttgaaaatggagataatccaactataatt
gtagatactttttttaagaaataccaagcaagacgatcagacaaaagtaagatcgattta
ttgtttcgttttattcaatatatagagcgtcaagttgttttatttgatgcaattgaagat
gcagcttttcctgtagttaataatatggatggtattggtacactacgaagtttaaaagaa
agcgctactgcagatggtaaattggacaaattacgtgagtatttagaagaatttaaagtg
cgaatagtgttaactgcgcatcctactcagttttatcctggaactgttttgggtattata
acagatctaaccgaagctgtgaaacaaaacgatttattacgtattaatgatttgttagct
caattaggtaaaaccccgttttttaaacatgaaaaaccaacaccttacgatgaagctgta
agtttaatctggtatttagaaaatgtgttttatgaatctttcggaaaaatttatgattac
atccagcaaaatatatttgatggacaacctatagataacaatataattaatgttggcttt
tggcctggtggagacagagatggtaacccgtttgttactccaaaaattacagttaaagtt
gctaaaaggttacacgaaaccattattaaaaactattataaagatatacgtaagttaaaa
cgaaagttaacttttcaaggtattgaaagccgaatttctaaaatagaaacagagttatac
aaaaaagtacttcatgaagagtctagtttaactttagaagcttttgtttcagaattaaaa
gatattagacaggttgtaattgaccaacaccaatctttatatgttactgagattactagt
ctacttaataaattacatttatttgggtttcatttttcaagtttagacattcgtcaagat
agtcgtgcacatcataaagtatttacagatatggttgatgttatgatagctaatggtagt
aaggatatccctaataattaccatgatttatcagaaacagaacaagtgaaaatcttatct
gaagttaaaggaaaagttgatttgtctttaattaaagatgaaaacacattaaaagcttta
aataccattaaagctattaaaactattcaagaaactaatggagaacaagcagccaaccga
tacataataagtaataatcaaacgacattaaatgtcatgcagttatttgcaatgttaaaa
cttgttgcttttcatgacgaattaacaatagatgttggaccattatttgaaactataaca
gatctagagaatgcacatcttgttatggaagagttatatactaatcctgcttacgcaaag
catttaaaagccagaggaaataagcaaactatcatgttaggttttagtgatggtactaaa
gatggtggttacttaatggctaattgggctatttataaagccaaagaacgcttaacagca
atttctagaaaatatgatgtaaccgtaatattttttgatggtcgtggtggaccaccagca
agaggaggaggtaaaactcataatttttacgcttcactaggtccaactatagaggataaa
gaagtacagttaactattcaaggtcagacgattagttctaattttggaacattagattcc
tcacaatataacttagagcaattaataagttctggtatttataatagtttaagtgatgcc
gatttaagtatggttccagaaaatagagtcgttatggataacttagcaaaactgagttac
caaacgtatgtagactttaaaaatcatcctaaatttatttcgtatttagagcatatgagt
acgcttaagtactacgcaaagactaatattgggagtagaccatctaaacgtggtaagtct
gaaggtttagtgtttgacgatttaagagctattccttttgtaggatcttggagtcaatta
aaacagaatgttcctggtttttttggtgttggtacagctttaaaacattatgaagatgca
ggcgagtttgaaaaagcacaacgcttatttaaaacctctagttttttcagaactttaata
gaaaatagtatgatgtcattatcaaaatcgttttttgatttgactaaatatatgagtgaa
gatcctgagtatggtgagttttggaacgtgatacatacagaatatttaacaacaaaacga
ttgattttaaaacttacaggctatactgaactgatggaggaagaaccatcaggtaaagca
tcaattaaagttagagagtccattgtgcttccattattgactattcagcaatttgcttta
aaacaaattcaagaattagaaaaagtagaagaaaaggatgtagacttaattgctgtatat
gaaaaactagtaacaagatcgttatttggaaatataaatgcgagtcgtaattcggcttaa

DBGET integrated database retrieval system