KEGG   Octadecabacter arcticus: OA238_c04220Help
Entry
OA238_c04220      CDS       T02539                                 

Definition
(GenBank) putative DUF81 family integral membrane protein
  KO
K07090  uncharacterized protein
Organism
oar  Octadecabacter arcticus
Brite
KEGG Orthology (KO) [BR:oar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    OA238_c04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF2053
Motif
Other DBs
NCBI-ProteinID: AGI70668
UniProt: M9RFY8
LinkDB All DBs
Position
434643..435386
Genome map
AA seq 247 aa AA seqDB search
MDGTLFWSLAVIAAVCTGLSKGGLPAFSMLAVPVLSLAISPITAAGLLLPVFLFSDIFGV
WAYRHEFRRDLLKIATVGTISGCTIGWTTAHIVSENLVRLLIGVIGATFALNLLLRRRAD
AAPRPPTWGRGVFWTTIAGFTSFVSHAGAPPWQIWVMPMGLTKMAFAGTTTIVFAMMNVT
KIVPYYFLGQFDPQNLRVAAMLLVPAVAGVYVGYRLTRVLPDKVFFGIVTWALLGISCKL
IWDGLLG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggacggaacactcttttggtcgctggccgtaatcgcggcggtgtgcacaggtctgtcc
aagggcggcttgccggcgttttcaatgttggcggtgcctgtgctgtcgctggctatttca
ccgattacggcagcggggcttttgttgccggtttttttgttttcggatatattcggcgtc
tgggcctaccgtcacgagtttcgccgcgacttgctgaaaatcgcgacagtggggacgatt
tcgggctgcacgattggctggacgacagcccatatcgtgtccgaaaatctggtcaggttg
ctgatcggggtgattggggcaacgtttgcgctgaatttgctgctgcgccgcagagcagat
gccgcgccgcggccaccgacatggggacgcggtgttttctggacaacgatcgcggggttc
accagttttgtgagccacgcgggcgccccgccgtggcaaatctgggtcatgccgatgggc
ctgacaaaaatggcttttgcaggcaccacgacaattgtttttgcgatgatgaatgtgaca
aaaatcgtgccctactactttttagggcaatttgatccgcaaaacttgcgcgttgcggcg
atgctgttggtccctgcggtggcgggcgtttatgtcggctatcgtttgacacgggtgctg
cctgacaaggtgttctttggcatcgttacatgggcgcttttggggatttcatgtaaattg
atctgggatgggctgttgggttag

DBGET integrated database retrieval system