KEGG   Octadecabacter arcticus: OA238_c04320Help
Entry
OA238_c04320      CDS       T02539                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
oar  Octadecabacter arcticus
Pathway
oar00020  Citrate cycle (TCA cycle)
oar00190  Oxidative phosphorylation
oar00650  Butanoate metabolism
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01120  Microbial metabolism in diverse environments
oar01130  Biosynthesis of antibiotics
oar01200  Carbon metabolism
Module
oar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OA238_c04320 (sdhA)
   00650 Butanoate metabolism
    OA238_c04320 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OA238_c04320 (sdhA)
Enzymes [BR:oar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OA238_c04320 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     OA238_c04320 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGI70678
UniProt: M9RFZ7
LinkDB All DBs
Position
441745..443550
Genome map
AA seq 601 aa AA seqDB search
MAEYEYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPAVQRTCAAADRTGHAILHTLYGQSLKQKAEFYIEYFAIDLIMSDDGV
CTGVVCWKLDDGTMHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLALQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPNYKDLAPRDYVSRCMTME
IREGRGVGDGKDHIHLNLNHLPAAALAERLPGISESAKIFAGVDVNKEPIPVLPTVHYNM
GGIPTNYFGEVLHPTKDNPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGTVVDRDAAIPVTHKPSVDKAFDRFDGLRNANGGTGTAELRLEMQKAMQEDAAVFRTD
KTLKEGVKKMTDIATKMGDLHVTDRSLIWNTDLMETLELSNLMPNALATIVGAEARKESR
GAHAHEDYATRDDEYWRVHTISHVDGAKVTLSHRPVITKPLTTEKEGGINLKQFAPKERT
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatacgaatacgaaacccacgaatatgatgtcgtcgtcgtcggcgcgggcggt
gcaggtttgcgcgccacgttgggcatggcggaacaaggtctgcggacggcctgtatatcc
aaggtgttcccgacgcggtcccacacggttgcagcacagggtggcatcgcggccagcctt
ggcaacatgggccccgacagctggcagtggcatatgtatgacacggtcaaagggtccgac
tggcttggtgacacggacgcgatggaatacctcgcgcgggaagcccccaaggcggtgtat
gagcttgagcattacggcgtgccgttttcgcgcaccgaagagggcaagatttatcagcgt
ccgtttggtggccacaccaccgaatttggcgaaggccccgccgtgcagcgcacctgtgcg
gccgccgaccggaccggccacgcgatcctgcacaccctgtatggccagtcgctcaagcaa
aaggctgaattctacatcgaatattttgccattgatttgatcatgtcagatgatggggtt
tgtacaggcgttgtctgttggaaactcgacgatggtacgatgcacgtgttcaacgccaag
atggttgttttggcgacaggtgggtatggccgcgcttatttcagcgccacatctgcgcat
acttgcaccggtgatggtggtggtatggtggcccgcgctgggctggcgttgcaggatatg
gaattcgtgcaattccacccgacaggcatttacgggtctggctgtttgattaccgagggc
gcgcgcggcgagggtggttatttgaccaactccgaaggcgagcggtttatggaacgctat
gcgccgaattacaaagaccttgcgccgcgcgattatgtatcgcgctgcatgacgatggaa
attcgcgaaggccgcggcgtaggcgacggaaaggaccacatccacctgaacctgaaccac
ctacccgcagcagcattggccgaacgccttccgggtatctccgaatccgccaagattttt
gcaggcgttgacgtgaacaaagaaccaatccctgtcttgccaactgtgcattacaatatg
ggtggcatcccgacgaactattttggtgaagtgttgcacccaaccaaagacaacccgaac
gcagttgtccctggcctgatggctgtgggcgaagccggctgtgcatcggtgcatggtgcg
aaccggcttgggtcgaattcactaatcgatctggtggtgtttggccgcgcggctgccatc
cgtgctggtacggtcgtggaccgcgacgcagcgattcctgtaacccacaaaccgtctgtt
gataaggcgttcgatcgttttgacgggttgcgcaatgcgaacggaggcacgggcactgcc
gagttgcgtttggaaatgcaaaaggcgatgcaagaagacgccgccgtgttccgcaccgat
aagacgctgaaagaaggcgtcaagaaaatgaccgacatcgccactaaaatgggcgatttg
cacgtcacggaccgatcattgatctggaataccgacttgatggagacgctggaactgtcg
aacctgatgcccaacgcgttggcgacgattgttggcgctgaggcgcgcaaggaaagccgt
ggtgcccacgcccacgaggattatgcgacgcgcgacgatgaatactggcgtgttcacacg
attagccatgtggatggtgccaaagtcacgctgagccatcgtccggtgatcaccaagcca
ctgacgacagaaaaagaaggcggcattaatcttaagcagttcgccccgaaagagcggacg
ttctga

DBGET integrated database retrieval system