KEGG   Octadecabacter arcticus: OA238_c04340Help
Entry
OA238_c04340      CDS       T02539                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
oar  Octadecabacter arcticus
Pathway
oar00020  Citrate cycle (TCA cycle)
oar00190  Oxidative phosphorylation
oar00650  Butanoate metabolism
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01120  Microbial metabolism in diverse environments
oar01130  Biosynthesis of antibiotics
oar01200  Carbon metabolism
Module
oar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OA238_c04340 (sdhB)
   00650 Butanoate metabolism
    OA238_c04340 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OA238_c04340 (sdhB)
Enzymes [BR:oar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OA238_c04340 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     OA238_c04340 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer2 Fer4_16 Fer4_18 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AGI70680
UniProt: M9RLH4
LinkDB All DBs
Position
444171..444950
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSRMTTGKTWPKPEGATNLRKVQIYRWSPDDDKNPSLDTYFVDMDACGPMVL
DALIKIKSDIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGMDEIKGDIKIYPLPHMP
VIKDLIPDLTHFYAQHASVKPWLETKSNKPAKEWKQSIEDRAKLDGLYECVMCACCTTAC
PSYWWNGDRFLGPAALLTANRWITDSRDEATGERLDDLEDPFKLYRCHTIMNCAKTCPKG
LNPAAAIANVKKMMIERTV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaactgaccctgcccaagaattcccgcatgacgacgggcaagacatggcccaaa
ccagagggggccacaaacctgcgcaaagtgcagatctaccgttggagcccggacgacgac
aagaaccctagtctggacacgtatttcgtggacatggacgcctgtggtccgatggttctg
gacgcgctgatcaagatcaaaagcgatattgatccaacattgacgttccggcggtcttgt
cgcgaaggtatctgcggcagctgcgcgatgaacattgatgggatcaacacgcttgcctgt
atctacggcatggatgagatcaagggcgatatcaaaatctatccgctgccgcatatgccg
gttatcaaagatttaatccccgacctgacacatttttacgcgcaacatgcatccgtgaag
ccctggttggagaccaagagcaacaagcccgcgaaggagtggaagcagtccatcgaggac
cgtgcgaagctcgatggtctttatgaatgcgtgatgtgcgcgtgttgcacgactgcgtgc
ccgagctactggtggaacggcgaccgtttccttggtcccgcagcgcttttgaccgcaaac
cgctggatcaccgacagccgcgacgaagcgacgggtgagcgtttggatgatcttgaagat
ccattcaagctgtaccgttgccacacgatcatgaactgcgccaagacctgcccgaagggt
ctgaaccctgcggcggccattgcgaatgtcaaaaagatgatgatcgaacgcacggtttga

DBGET integrated database retrieval system