KEGG   Octadecabacter arcticus: OA238_c30600Help
Entry
OA238_c30600      CDS       T02539                                 

Gene name
fabI1
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase1 [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
oar  Octadecabacter arcticus
Pathway
oar00061  Fatty acid biosynthesis
oar00780  Biotin metabolism
oar01100  Metabolic pathways
oar01130  Biosynthesis of antibiotics
oar01212  Fatty acid metabolism
Module
oar_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OA238_c30600 (fabI1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OA238_c30600 (fabI1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    OA238_c30600 (fabI1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:oar01004]
    OA238_c30600 (fabI1)
Enzymes [BR:oar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     OA238_c30600 (fabI1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     OA238_c30600 (fabI1)
Lipid biosynthesis proteins [BR:oar01004]
 Fatty acid synthase
  Component type
   OA238_c30600 (fabI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AGI73067
UniProt: M9RLL7
LinkDB All DBs
Position
3245411..3246202
Genome map
AA seq 263 aa AA seqDB search
MTIDMNGKRGLIMGVANNRSIAWGIASAMHKAGAELAFSYQGESLLKRVGPLAESVGSDT
LVEADVMDDASLDRCFATLKEKWGKIDFLVHAIAYSDKNELTGRVSDTSRANFNTTMAIS
CFSFIDVARRAAEIMPDGGTLLTLTYQGSHGVTPNYNVMGVAKAALESATMYLAADLGPQ
QIRVNAISPGPMKTLAGAAIAGARRTFRYAEQNSPLRHNATLDAVGGTAVYLASDAGACT
TGEIIHVDSGLHTIMMPPLENLG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgatatgaacggcaaacgcggcctcatcatgggcgtcgccaacaaccgctct
attgcgtggggcatcgcatcagccatgcacaaggcgggcgcggaactggcgttttcctat
caaggcgaaagcctgttgaaacgcgtcgggccacttgcggaatcggtcgggtcagacacg
ctggttgaggccgatgtgatggacgatgcatcactagatcgttgttttgcaaccctgaaa
gaaaagtggggcaagatcgattttctggtccacgccatcgcttattctgacaaaaacgaa
ctcacgggccgcgtgtctgacaccagtcgcgcgaactttaacacaaccatggcgatcagc
tgtttcagcttcatcgacgtggcgcggcgtgctgcggaaatcatgccagacggcggcaca
ttgctgacactgacctaccaaggcagtcatggcgttacacccaattataacgtcatgggt
gtcgccaaggccgcgttggaatcagcaacaatgtacctcgcagccgaccttggcccgcaa
caaatccgcgtcaatgcgatcagtcccggtccgatgaaaacccttgcgggtgccgccatc
gcaggggcacggcgcacgttccgatacgccgaacaaaactcccccctgcgccacaacgcg
acgcttgatgccgtcggtggcacagctgtctatctggcgtctgatgcgggggcttgcacg
acaggcgaaatcatccacgtggattccggactgcacacgatcatgatgccaccgcttgaa
aaccttggttga

DBGET integrated database retrieval system