KEGG   Octadecabacter arcticus: OA238_c33880Help
Entry
OA238_c33880      CDS       T02539                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
oar  Octadecabacter arcticus
Pathway
oar00240  Pyrimidine metabolism
oar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    OA238_c33880 (tdk)
Enzymes [BR:oar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     OA238_c33880 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_19 AAA_14
Motif
Other DBs
NCBI-ProteinID: AGI73365
UniProt: M9RU67
LinkDB All DBs
Position
3594015..3594611
Genome map
AA seq 198 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQAAHNYAERGMQTYLLTAQFDNRAGAGRIASRIGIGEPAD
TFARNDDLFRKIEQRMAAGPCACVFIDEAQFLSTDQVWQLARAVDDLGLPVMTYGLRVDF
MGELFPGSATLLALADEMREIRTICFCGKKATMVVRKDGNGDVVTGGNQVQIGGNETYVS
LCRRHWREAVDDGDATLV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaactattcgacgatgaacgctggcaaatcgacggtgctgttg
caggccgcgcataattacgcagaacgcggcatgcagacctatttgttgaccgcgcaattt
gacaatcgcgcaggggcaggacgcatcgcaagccggatcggcatcggagagccagcagat
acatttgcgcgcaacgatgatttgtttcgcaagatagaacagcgcatggcagcagggccc
tgtgcctgcgtgttcatcgacgaggcgcaattcctcagcactgatcaggtctggcaattg
gcgcgcgcggtcgatgaccttggattaccggttatgacctacgggctgcgcgttgatttc
atgggggagctgttcccgggatcagccacgctcctcgcgcttgcggatgaaatgcgcgag
atcagaaccatctgtttttgcggcaagaaagccacgatggtcgtgcgcaaagacggcaac
ggcgacgtcgtgacgggtggcaatcaagtgcagatcggcggcaatgaaacctacgtcagc
ctgtgccgtcgccattggcgcgaggccgttgacgacggtgacgccacactggtttag

DBGET integrated database retrieval system