KEGG   Ovis aries (sheep): 100036759Help
Entry
100036759         CDS       T03117                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00010  Glycolysis / Gluconeogenesis
oas00051  Fructose and mannose metabolism
oas00052  Galactose metabolism
oas00500  Starch and sucrose metabolism
oas00520  Amino sugar and nucleotide sugar metabolism
oas00524  Neomycin, kanamycin and gentamicin biosynthesis
oas01100  Metabolic pathways
oas01200  Carbon metabolism
oas04066  HIF-1 signaling pathway
oas04910  Insulin signaling pathway
oas04930  Type II diabetes mellitus
oas04973  Carbohydrate digestion and absorption
oas05230  Central carbon metabolism in cancer
Module
oas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oas_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100036759 (HK1)
   00051 Fructose and mannose metabolism
    100036759 (HK1)
   00052 Galactose metabolism
    100036759 (HK1)
   00500 Starch and sucrose metabolism
    100036759 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100036759 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100036759 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100036759 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100036759 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100036759 (HK1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100036759 (HK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100036759 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    100036759 (HK1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100036759 (HK1)
Membrane trafficking [BR:oas04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100036759 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 100036759
NCBI-ProteinID: XP_014959890
Ensembl: ENSOARG00000005491
LinkDB All DBs
Position
25
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMNRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQAVHMESEVYDTPENIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSRIDEAILITWTKRFKASGV
EGTDVVKLLDKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQLCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSNDDCVSVQHVCTIVSFRSANLVAATLGAILSRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFSLT
KEMLLEVKKRMRAEMELGLGKQTHDKAVVKMLPSFVRSIPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRSVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPSCEVGLIVGTGSNACYMEEMKNVETLEGNQGQMCINMEWGAFGDNGCLDD
IRTIYDKLVDEFSLNSGKQRYEKMISGMYLGEIVRNILIDFAKRGFLFRGQISEPLKTRG
LFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRQEMSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctagcttattacttcaccgaactgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaactctgttagatatcatg
aatcgtttcaaaaaggagatgaagaatggcctctcccgggattttaatccgacagccaca
gtcaagatgttgccaacatttgtaaggtctattcccgatggctcagaaaaaggagatttc
atcgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaggtgaatcatgag
cagaaccaggctgttcatatggagtctgaggtttatgacaccccagagaacatcatgcat
ggcagtggaagccagctttttgatcacgtcgctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacattttctttcccttgtcggcaa
tccagaatagacgaggccatcctgatcacctggacaaagagattcaaagcaagcggcgtg
gagggaactgatgtggtgaagctgcttgacaaagccatcaaaaagcgtggggactatgat
gccaacattgtggctgtggtgaacgacacggtggggaccatgatgacctgtggctacgac
gaccagctgtgtgaagtcggcctcatcattggtactggcaccaacgcgtgctacatggag
gagctgaggcacatcgacctggtggagggcgacgaggggaggatgtgcatcaacaccgag
tggggggcctttggggacgacggggccctggaggacatccgcactgagttcgaccgggag
atagaccgggggtcgctcaaccccgggaagcagctgttcgagaagatggtcagtggcatg
tacctcggcgagctggtccgactgatcctggtcaagatggccaaggagggccttttattt
gaagggcggatcactcccgagctgctcaccagagggaagtttaacaccagtgatgtgtcg
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtctaatgacgactgtgtttcggttcagcacgtgtgcaccatcgtctcattt
cgctctgccaacctggtggcggcgaccctgggcgccatcttgagccgcctccgagataac
aagggcacgcccaggctgcggaccacggttggtgtcgacgggtccctttacaagacgcac
ccacagtattctcggcgtttccacaagactctgcggcgcttggtacccgactgcgatgtg
cgtttcctcctctccgagagcggcagtggcaagggggccgccatggtgactgctgtggcc
taccgcctggctgagcagcaccggcagatagaagaaaccctggcccacttcagtcttacc
aaggaaatgctgctggaggtgaaaaagaggatgcgggctgagatggaattggggctgggc
aagcagacgcatgacaaggctgtggtcaagatgctgccctccttcgtccggagcattcct
gatgggactgagaatggtgacttcttggccctggatcttggaggaacgaatttccgcgtc
ctgctggtgaaaatccgtagtgggaaaaagagatcggtggaaatgcacaataagatctat
gccattcccattgaaatcatgcagggcactggggaggagctgtttgaccacatcgtttcc
tgcatctctgacttcctggactacatgggcatcaagggccctaaaatgcctctgggcttc
acattttcgtttccctgcaagcagacgagcttagatgcgggtatcttaatcacctggacc
aaaggttttaaggcaaccgactgcgtggggcacgacgtagcaaccttactgagggaggcg
ataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttatgaggagcccagctgcgaggttggactcattgtagggact
ggcagcaatgcctgctacatggaggaaatgaaaaacgtcgagacgctagaaggaaaccag
ggacaaatgtgtatcaacatggagtggggggcctttggggacaacgggtgtctggatgat
atcagaacaatctatgacaaactggtggatgagttttctctaaactctgggaagcaaagg
tatgagaagatgatcagcggtatgtacctgggtgagattgtccgcaacatcttgatcgac
tttgccaagaggggcttcctcttccgggggcagatctctgagccgctgaagacccggggc
ctctttcagaccaagtatctctctcagatcgagagcgaccgattagcgctactgcaggtc
cgggccatcctccagcagctgggtctgaacagcacatgcgacgacagtatcctcgtgaag
accgtgtgtggggtggtgtccaagagggcagcgcagctgtgtggcgcaggcatggctgct
gtggtggataagatccgcgaaaacagggggctggaccgcctcaacgtgactgtgggcgtg
gacggcacgctctacaagcttcatccgcacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcttatccgaagacggcagcggcaaggga
gccgccctcatcacagcagtgggcgttcggctccggcaagaaatgagcagctaa

DBGET integrated database retrieval system