KEGG   Ovis aries (sheep): 100036762Help
Entry
100036762         CDS       T03117                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00020  Citrate cycle (TCA cycle)
oas00190  Oxidative phosphorylation
oas01100  Metabolic pathways
oas01200  Carbon metabolism
oas04714  Thermogenesis
oas04932  Non-alcoholic fatty liver disease (NAFLD)
oas05010  Alzheimer disease
oas05012  Parkinson disease
oas05016  Huntington disease
Module
oas_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oas_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oas_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100036762 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100036762 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100036762 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100036762 (SDHA)
   05012 Parkinson disease
    100036762 (SDHA)
   05016 Huntington disease
    100036762 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100036762 (SDHA)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100036762 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 100036762
NCBI-ProteinID: XP_011952573
Ensembl: ENSOARG00000015619
LinkDB All DBs
Position
16
AA seq 665 aa AA seqDB search
MAGVAAVSRLLRARRLALNCTKRPAAWQTGARDFHFTVDGNKRSSAKVSDAISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGALTPSTNMTEQAPLGVPQLENYGMPFSRTEDGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLPTLYGRSLRYDTSYFVEYFALDLLMESGECRGVIALCI
EDGSIHRIRARNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLKHVNGRDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPSIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKI
SSLYGDLRHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKE
RVDEYDYSKPVQGQQKKPFEQHWRKHTLSYVDVKTGEVTLEYRPVIDRTLNETDCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctggggttgccgctgtgtcgcgcttgctgcgcgctcggcgcctggcgctgaactgc
acgaagcggccggcagcatggcagacaggagcccgcgactttcacttcaccgttgacggc
aataagaggtcgtccgctaaagtttcagatgcgatctctgcgcagtacccagtcgtggac
catgagtttgatgccgtggtggtcggtgcagggggggcaggcctgcgggccgcgttcggc
ctctccgaagcaggtttcaacacggcctgcgtcacgaagctcttccccaccaggtcccat
actgtcgcggcccagggagggatcaatgccgccctggggaacatggaggaggacaactgg
cggtggcacttctacgacaccgtgaagggctccgactggctgggggccctgactccttcc
actaacatgacggagcaggcccccctgggtgttcctcagctggagaattacggcatgccc
tttagcagaactgaagatgggaagatctaccagcgtgcctttggcggacagagcctcaag
ttcgggaagggcgggcaggcccaccgctgctgctgcgtggctgaccgcacgggccactcg
ctgctacccaccttgtatggaaggtccctgcgctacgacaccagctactttgtggagtac
tttgccctggacctcctgatggagagcggggagtgccgcggcgtgatcgctctgtgcata
gaagacgggtccatccaccgcatcagggccaggaacaccgtcatcgccaccggaggctac
gggcgcacctacttcagctgcacgtcggcgcacaccagcaccggggacggcaccgccatg
gtgaccagggctggcctgccctgccaggacctggagttcgtgcagttccaccccacaggc
atatatggcgctggctgtctcatcacggagggctgtcgtggagaggggggcatcctcatc
aacagccagggtgagaggttcatggagcgctatgcccccgtcgctaaggacctggcatct
agggacgtcgtgtcccggtccatgaccctggaaatccgcgagggaagaggctgtgggccc
gagaaggaccacgtgtacctgcagctgcaccacctgccgccagagcagctggccatgcgc
ctgcccggcatctcagagacggccatgatcttcgcgggcgtggacgtcaccaaggagccc
atccccgtgcttcccaccgtgcactacaacatgggtggcatccccaccaactacaagggg
caggttctgaagcacgtgaatggccgggaccaggttgtgcccggcctgtatgcatgcggg
gaggctgcctgcgcctcggtgcatggcgccaaccgtctgggtgcaaactcgctcctggac
ctggtggtcttcggccgggcgtgcgccctgagcatcgcagagtcctgcagacctggagat
aaagttccctcaattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattg
agatttgccgatggaagcataagaacatcggaattgcgactcagcatgcagaagtcgatg
cagagccatgccgcggtgttccgtgtgggcagtgtgctgcaggaaggctgtgagaagatc
agcagcctctacggagacctgcggcatctgaagacgttcgacaggggaatggtctggaac
actgacctggtggagaccctggagctgcagaacctgatgctttgtgctctgcagaccatc
tatggagcggaggcccggaaggagtcgcgtggcgcccatgccagggaggacttcaaggag
agggttgacgagtacgattactccaagcccgtccaggggcagcagaagaagccgtttgag
cagcactggaggaagcacacgctctcctacgtcgacgtcaagactggggaggtcaccctg
gaatacagacctgtgatcgacaggactttgaacgagaccgactgtgccactgtcccccca
gccatccgctcctactga

DBGET integrated database retrieval system