KEGG   Ovis aries (sheep): 100127209
Entry
100127209         CDS       T03117                                 

Gene name
HSP90AA1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
oas  Ovis aries (sheep)
Pathway
oas04141  Protein processing in endoplasmic reticulum
oas04151  PI3K-Akt signaling pathway
oas04217  Necroptosis
oas04612  Antigen processing and presentation
oas04621  NOD-like receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04659  Th17 cell differentiation
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas05132  Salmonella infection
oas05200  Pathways in cancer
oas05215  Prostate cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100127209 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100127209 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100127209 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100127209 (HSP90AA1)
   04612 Antigen processing and presentation
    100127209 (HSP90AA1)
   04659 Th17 cell differentiation
    100127209 (HSP90AA1)
   04657 IL-17 signaling pathway
    100127209 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100127209 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    100127209 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100127209 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100127209 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100127209 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100127209 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    100127209 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oas03110]
    100127209 (HSP90AA1)
   04131 Membrane trafficking [BR:oas04131]
    100127209 (HSP90AA1)
   03051 Proteasome [BR:oas03051]
    100127209 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:oas03029]
    100127209 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    100127209 (HSP90AA1)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100127209 (HSP90AA1)
Chaperones and folding catalysts [BR:oas03110]
 Heat shock proteins
  HSP90
   100127209 (HSP90AA1)
Membrane trafficking [BR:oas04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100127209 (HSP90AA1)
Proteasome [BR:oas03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100127209 (HSP90AA1)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100127209 (HSP90AA1)
Exosome [BR:oas04147]
 Exosomal proteins
  Proteins found in most exosomes
   100127209 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 100127209
NCBI-ProteinID: XP_027813217
Ensembl: ENSOARG00000003903
UniProt: A0A6P7D3W0
LinkDB
Position
18
AA seq 733 aa
MPEETQAQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcccgaggagacccaggcccaggaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggaaattgcccagttgatgtcattgatcatcaacactttctactcgaat
aaagagattttcctgagggagctgatttcaaactcgtcagacgccctggacaagatcagg
tatgagagcttgaccgatcccagtaaattagactcggggaaagagctgcacattaatctc
ataccgaacaagcaagatcgaaccctcaccatcgtggacaccggcattgggatgaccaag
gccgatttgattaataatctgggcaccatcgccaagtctgggaccaaagcgttcatggag
gctttgcaggctggcgctgatatctccatgattggccagtttggtgtcgggttttattca
gcctatttggtggctgagaaagtgaccgtcatcaccaaacataacgatgatgagcagtat
gcctgggagtcttctgcaggagggtccttcacagtgaggactgacacaggagaaccgatg
gggcgtggaacaaaggttattctgcatctgaaagaagaccagactgagtacctggaggag
cggagaataaaggagattgtgaagaagcattctcagttcattggctatcccatcactctt
tttgtggaaaaggaacgtgataaagaagttagcgatgatgaagcagaagagaaggaagac
aaagaggaagagaaggagaaagaagaaaaggagtctgatgacaagcccgagatagaagac
gttggctcagatgaagaggaggaagagaagaaggatggggacaagaagaagaagaagaag
atcaaggagaagtacatcgatcaagaagagctgaacaagacaaagcctatctggaccaga
aaccctgatgacatcactaacgaggagtatggagagttctacaagagcctgaccaacgac
tgggaggaccacttggcggtcaagcatttttcagttgaaggacagttggaattcagagcc
cttctttttgtcccaagacgagctccttttgacctgtttgaaaacagaaagaagaagaac
aacattaagctgtatgttcgcagagttttcatcatggataactgtgaggagctaatccct
gaatacctgaatttcattagaggtgtggtggattctgaggatcttcctctgaacatttcc
cgtgagatgttgcaacagagcaaaattttgaaagttatcaggaagaatttggtcaaaaag
tgcttggaactcttcactgaactggcagaagataaggagaactacaagaagttttatgag
cagttctctaaaaatattaagcttggaatacatgaagattcccaaaatcggaagaagctt
tcagagctgttgaggtactatacttctgcttctggtgatgagatggtttctctcaaggac
tattgcacaagaatgaaggaaaaccagaaacacatctattacatcacaggtgagacaaag
gaccaggtagccaactcggcctttgtggagcgtctccggaagcatggtttggaagtgatc
tacatgattgagcctattgatgagtactgtgtgcaacagctgaaggagtttgaggggaag
accttagtgtcagtcaccaaagagggcctggaacttccagaagatgaggaagagaaaaag
aaacaagaagagaaaaagacaaagtttgaaaacctctgcaaaatcatgaaggacattttg
gagaagaaagttgaaaaggtggtcgtgtccaaccggctggtgacctccccgtgctgcatt
gtcacaagcacatacggctggacagcaaacatggagcggatcatgaaggcgcaagccctg
agagacaactcgacgatgggttacatggcagccaagaagcacctggagatcaaccctgac
cattccatcatcgagaccttgaggcaaaaggcagaggctgacaagaatgacaagtctgtg
aaggatctggtcatcctgctgtacgaaacagcgctcctgtcttctggcttcagtctggag
gatccccagacacacgccaacaggatctacaggatgatcaaacttggtcttggtattgac
gaggatgaccccactgctgacgacagcagcgctgcagtcactgaggaaatgccgcccctg
gaaggagacgacgacacgtcccgcatggaggaagtagactga

KEGG   Ovis aries (sheep): 101111703
Entry
101111703         CDS       T03117                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
oas  Ovis aries (sheep)
Pathway
oas04141  Protein processing in endoplasmic reticulum
oas04151  PI3K-Akt signaling pathway
oas04657  IL-17 signaling pathway
oas04915  Estrogen signaling pathway
oas04918  Thyroid hormone synthesis
oas05132  Salmonella infection
oas05200  Pathways in cancer
oas05215  Prostate cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101111703 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101111703 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101111703 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101111703 (HSP90B1)
   04918 Thyroid hormone synthesis
    101111703 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101111703 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101111703 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101111703 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101111703 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oas03110]
    101111703 (HSP90B1)
Chaperones and folding catalysts [BR:oas03110]
 Heat shock proteins
  HSP90
   101111703 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 MH1 DUF4518
Other DBs
NCBI-GeneID: 101111703
NCBI-ProteinID: XP_012030315
Ensembl: ENSOARG00000016366
UniProt: A0A6P3TF14
LinkDB
Position
3
AA seq 804 aa
MRVLWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDSQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPAEEEEAGK
EDKEESDDEAAVEEEEDEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDMTSLDQYVERMKEKQDKIYF
MAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKSKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTAEDTEQDEEE
EMDAGTDEEEQETAEKSTAEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggtcctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcagtgcgg
gctgatgatgaagtggatgtggatgggacagtggaagaagatctgggtaaaagtagagaa
ggctcaaggacagatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcccagataagagaactcagagagaaatcagaaaagtttgccttccaagct
gaagttaacagaatgatgaaactcatcatcaattcattgtataaaaacaaagagattttc
ctgcgagaactgatttcaaatgcttctgatgctttagataagataagactaatatcactg
actgatgaaaatgctcttgctggaaatgaggagttgacagttaaaattaagtgtgataag
gagaagaacctgctccacgtcacagacactggtgtaggaatgacccgggaggagttagtg
aaaaaccttggcaccatagccaagtctgggacaagtgagtttttaaacaaaatgactgag
gcacaagaagatggccaatcaacgtcagaactgatcggtcagtttggtgttggtttctat
tctgccttccttgtggcagataaagttattgtcacatcgaaacacaacaatgactctcaa
cacatctgggagtccgactccaatgaattttctgtaatcgctgaccccagaggaaacact
ctcggacggggaacaaccattacccttgttttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaacctcgtgaaaaaatattcacagttcataaactttcctatttat
gtatggagcagcaagactgaaacggttgaggaacctgccgaagaagaagaagcaggaaaa
gaagataaagaagaatctgatgatgaagctgccgtagaagaagaagaagacgaaaagaaa
ccaaaaactaaaaaagttgaaaaaactgtctgggattgggaactgatgaatgatatcaaa
cccatatggcagagaccatcgaaagaagtagaggaggatgaatacaaagctttctacaaa
tcattttcaaaggaaagcgatgaccccatggcatatatccactttactgctgaaggagaa
gttaccttcaagtcaattttattcgtacccacatctgccccacgtggtctgtttgatgaa
tatggatccaagaagagcgattacattaagctgtatgtgcgccgagtattcatcacagac
gatttccatgatatgatgcccaaatacctgaattttgtcaagggtgttgtggactcggat
gatctccccttgaatgtttcccgtgagactcttcagcaacataaactgcttaaggtgatt
agaaagaagcttgtccgtaaaactctggacatgatcaaaaagattgctgatgaaaaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgatagaagatcac
tcaaatcgaacacgtcttgccaaacttcttagattccaatcttctcatcatccaagtgac
atgactagtctagaccagtatgtggaaagaatgaaggagaagcaggacaaaatctacttc
atggctggggccagcaggaaagaggccgaatcttctccctttgttgagcgacttctgaaa
aagggctatgaagtgatttatctcacagaacctgtggatgaatactgcattcaggctctt
cccgaattcgatgggaagaggttccagaatgttgccaaagaaggagtgaagtttgatgaa
agtgagaaaagtaaggagagtcgtgaagcagttgagaaagaatttgagcctctgctaaac
tggatgaaagataaagccctcaaggacaagatcgagaaggctgtggtgtctcagcgcctg
acagaatctccatgtgctctggtagccagccagtatgggtggtctggcaacatggaaagg
atcatgaaagcccaggcataccagacaggcaaggacatctcaaccaattattatgccagc
cagaagaaaacatttgaaattaaccccagacacccactgattagagacatgcttcgaaga
gttaaggaagatgaagatgacaaaactgttttggatcttgctgtagttttgtttgaaaca
gcaacactgcggtcagggtatcttttaccagacactaaggcatatggagacagaatagaa
agaatgcttcgcctcagcttaaacatcgaccctgacgcaaaggttgaagaagaacccgaa
gaagaacccgaggaaacagcagaggacaccgcagaagacacagagcaggacgaagaggaa
gagatggacgcaggaacagatgaggaagagcaggaaacagcagagaaatcgacagctgaa
aaagatgaactgtaa

KEGG   Ovis aries (sheep): 101117797
Entry
101117797         CDS       T03117                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
oas  Ovis aries (sheep)
Pathway
oas04141  Protein processing in endoplasmic reticulum
oas04151  PI3K-Akt signaling pathway
oas04217  Necroptosis
oas04612  Antigen processing and presentation
oas04621  NOD-like receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04659  Th17 cell differentiation
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas05132  Salmonella infection
oas05200  Pathways in cancer
oas05215  Prostate cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101117797 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101117797 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101117797 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101117797 (HSP90AB1)
   04612 Antigen processing and presentation
    101117797 (HSP90AB1)
   04659 Th17 cell differentiation
    101117797 (HSP90AB1)
   04657 IL-17 signaling pathway
    101117797 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101117797 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    101117797 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101117797 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101117797 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101117797 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101117797 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    101117797 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:oas03110]
    101117797 (HSP90AB1)
   04131 Membrane trafficking [BR:oas04131]
    101117797 (HSP90AB1)
   03051 Proteasome [BR:oas03051]
    101117797 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:oas03029]
    101117797 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    101117797 (HSP90AB1)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101117797 (HSP90AB1)
Chaperones and folding catalysts [BR:oas03110]
 Heat shock proteins
  HSP90
   101117797 (HSP90AB1)
Membrane trafficking [BR:oas04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101117797 (HSP90AB1)
Proteasome [BR:oas03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101117797 (HSP90AB1)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101117797 (HSP90AB1)
Exosome [BR:oas04147]
 Exosomal proteins
  Proteins found in most exosomes
   101117797 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 101117797
NCBI-ProteinID: XP_004018903
Ensembl: ENSOARG00000009343
UniProt: A0A6P3EJ72 W5PHW0
LinkDB
Position
20
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacatttgccttccaggcagaa
attgcccaactcatgtctcttattatcaacaccttctattccaacaaggaaatttttctt
cgggagttgatcagtaatgcttctgatgccttggacaagattcgctatgaaagcctgaca
gacccttctaaattggacagtggtaaagagctgaaaattgacatcatcccgaatccccag
gagcgtactctgactctggtagacacgggcattggcatgaccaaagctgatcttgtaaat
aatttgggaaccattgccaagtctggcactaaagcatttatggaggctcttcaggctggt
gcagacatctccatgattgggcagtttggtgtgggcttctactctgcctacctagtggca
gagaaagtggtggtgatcacaaagcataatgatgatgaacagtatgcttgggagtcttct
gccgggggttccttcactgtccgggctgaccatggtgagcctattggccgtggtaccaaa
gtgattctccacctgaaggaagaccagacagaatacttggaagagaggcgggtcaaagaa
gtggtgaagaagcactctcagttcataggctatcccatcacactttatctggagaaagaa
cgtgagaaggaaatcagtgatgatgaggctgaagaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagagaagcctaagattgaagatgtgggctcagacgaggaggatgat
agtggcaaggataagaaaaagaagacaaagaagataaaggagaagtacattgatcaggaa
gaactgaacaaaaccaagcccatttggaccaggaaccctgatgacatcacccaggaggaa
tatggagagttctacaagagtcttaccaatgactgggaagatcacttggcagtgaagcac
ttctctgtagaaggtcagctggaattcagagcactgctgttcatcccccgtcgggctcct
tttgacctcttcgagaacaaaaagaaaaagaacaatatcaaactgtatgtccgccgtgtg
ttcatcatggacagctgtgatgagttgattccggaatatctcaacttcatccgtggggtg
gttgactctgaagaccttcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaggttattcgtaagaacattgttaagaagtgccttgagctcttctctgagctagca
gaagacaaggagaactataagaaattctatgaggcattctctaaaaacctgaagcttgga
atccatgaggactccactaaccggcgacgcctttctgagctgctgcgctatcacacgtcc
cagtctggagatgagatgacttctctctcagaatatgtgtctcgcatgaaggagacccag
aagtccatctattacatcactggtgagagcaaagagcaggttgccaactctgcatttgtg
gagcgcgtgcggaagcggggctttgaggtggtgtacatgacggagcccatcgacgagtac
tgtgtacagcagctcaaggagtttgatgggaagagtctggtctctgtgaccaaggagggc
ctggagctgcctgaggatgaggaggagaagaagaagatggaggagagcaaggcaaagttt
gagaacctctgcaaactcatgaaggagatcttggataagaaggtggagaaggtgacgatc
tccaacaggctcgtgtcctcaccctgctgcattgtgaccagcacctacggctggaccgcc
aacatggagcgcatcatgaaagcccaggcactgcgggacaactcgaccatgggctacatg
atggccaaaaagcacctggagatcaaccctgaccaccccatcgtggagaccctgcggcag
aaggcagaggcggacaagaacgacaaggccgtcaaggacctggtggtgctactgttcgaa
actgcactgctctcctctggcttctcgcttgaggatccccagacccactccaaccgtatc
taccgcatgataaagcttggcttgggcattgatgaagatgaggtgacggcagaggagccc
agtgctgctgttcctgatgagattcccccccttgagggtgacgaggacgcctctcgcatg
gaagaagtagattag

DBGET integrated database retrieval system