KEGG   Ovis aries (sheep): 100144755
Entry
100144755         CDS       T03117                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04110  Cell cycle
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100144755 (RB1)
   04218 Cellular senescence
    100144755 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100144755 (RB1)
   05203 Viral carcinogenesis
    100144755 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100144755 (RB1)
   05225 Hepatocellular carcinoma
    100144755 (RB1)
   05226 Gastric cancer
    100144755 (RB1)
   05214 Glioma
    100144755 (RB1)
   05220 Chronic myeloid leukemia
    100144755 (RB1)
   05218 Melanoma
    100144755 (RB1)
   05219 Bladder cancer
    100144755 (RB1)
   05215 Prostate cancer
    100144755 (RB1)
   05224 Breast cancer
    100144755 (RB1)
   05222 Small cell lung cancer
    100144755 (RB1)
   05223 Non-small cell lung cancer
    100144755 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100144755 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100144755 (RB1)
   05161 Hepatitis B
    100144755 (RB1)
   05160 Hepatitis C
    100144755 (RB1)
   05163 Human cytomegalovirus infection
    100144755 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100144755 (RB1)
   05169 Epstein-Barr virus infection
    100144755 (RB1)
   05165 Human papillomavirus infection
    100144755 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100144755 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    100144755 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    100144755 (RB1)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100144755 (RB1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100144755 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 100144755
NCBI-ProteinID: XP_027829363
Ensembl: ENSOARG00000008246
UniProt: A0A6P7EE23
LinkDB
Position
10
AA seq 925 aa
MPPKTPRRAAAAAAAAAEPPPPPPPPEEDPEQDSGSEDLPLARLEFEETEEPDFTALCQK
LKIPDHVRERAWLTWEKVSSVDGVLEGYVQKKKELWGICIFIAAVDLDEMPFTFTELQKN
IETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSSIST
EINSMLVLKVSWITFLLAKGQVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPYKTAV
IPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSL
GIVASNGLPEVENLSKQYEEIYLKNKDLDARLFLDHDKTLQADPTDSFEMQRTPRKSNPD
EEVNMILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIG
DIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFH
MSLLACALEVVMATYSRSMSQSLDTGTDLSFPWILNVFNLKAFDFYKVIESFIKAEANLT
REMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPVDHFEPACTLNLPLQNNHTAA
DMYLSPVRSPKKKASTPRANSTPNSEAQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLN
TLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKI
IVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIP
HIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGLPTPTKMTPRSRILVSIGESFGTSE
KFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAE
MTSTRTRMQKQKMNESMDTSNREEK
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagccgccgccgccgccgccgccgcggagcccccg
ccgccgccgccgccccctgaggaggaccccgagcaggacagcggctccgaggacctgcct
ctggccaggcttgagtttgaagaaactgaagaacctgattttactgcattatgtcagaaa
ttaaagataccagatcatgtcagagaaagagcttggttaacttgggaaaaagtttcatct
gtggatggagtattggaaggttatgttcaaaagaaaaaggaactgtggggaatctgtatc
tttattgcagcagttgacttagatgagatgccattcactttcactgagctacagaaaaat
attgaaaccagtgtctataaattctttgatttactaaaagaaatcgatactagcaccaaa
gttgataatgctatgtcaagactgttgaagaagtataatgtgttgtgtgcactctacagc
aaattagaaaggacatgtgagcttatatatttgacacaacccagcagttcgatatccact
gaaataaattccatgttggtgctaaaagtttcttggatcacatttttattagctaaagga
caagtattacaaatggaagatgatctggtgatctcatttcaattaatgctgtgtgtcctt
gactattttatcaaactctcacctcctgcattgctcaaagaaccatataaaacagctgta
atacctattaatggttcacctcgaacaccaaggcgaggtcagaacaggagtgcacggata
gcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaatgt
aatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatgaattctctt
ggaattgtagcttctaatggacttccagaggtggaaaatctctctaaacaatatgaagaa
atttaccttaaaaacaaagatctagatgcaagattatttctggatcatgataaaactctt
caggctgatcctacagacagttttgaaatgcaaagaacaccacggaaaagtaaccctgat
gaagaggtgaatatgattcttccacagactccagttaggactgttatgaatactatccaa
caattaatgatgatcttaaattcagcgagtgatcaaccatcggaaaatctgatttcctat
tttaataattgtacagtgaatccaaaggaaagtatcctgaaaagagtgaaggatattggg
gacatctttaaagagaaatttgctaaagctgtgggacaaggatgtatggaaattggatca
cagcgatacaaacttggagtccgattgtattaccgagtaatggagtccatgcttaaatca
gaagaagaacgattatccattcaaaattttagcaaactcctgaatgacaacatctttcat
atgtctttgttggcatgcgctcttgaggttgtaatggctacctatagcagaagtatgtct
cagagcctggatactgggacagatctatccttcccatggattctgaatgtatttaactta
aaagcttttgatttttacaaagtgattgaaagtttcatcaaagcagaagccaacctgacc
agagaaatgattaaacatttagaacgatgtgaacatcggatcatggagtcccttgcatgg
ctctcagattcacctttatttgatcttattaaacaagcaaaggaccgagaaggaccagtt
gatcactttgaacctgcctgtactctcaaccttcctctccagaataatcacactgcagca
gatatgtacctttctcctgtaagatccccaaagaaaaaagcgtcaactccacgtgcaaat
tctactccaaattcagaggcacaagcaacctcagccttccagactcagaagccattgaaa
tctacctccctttcactcttctacaaaaaagtgtatcgactagcatatcttcgactgaac
accctgtgtgcacgccttctgtctgaccacccagagctagagcatatcatctggaccctt
ttccagcacacactgcaaaatgagtatgaactcatgagagacaggcatttggaccagatt
atgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaattcaaaatc
attgtcacagcgtacaaagatcttcctcatgctgttcaggagacattcaaacgtgttttg
atcagagaagaggagtatgattccattatcgtattctataattcagtcttcatgcagaga
ctgaaaacaaatattctgcagtatgcttccaccaggccccctaccttgtcaccgattcct
cacattcctcgaagcccttacaagttttctagttcacctttacggattcctggggggaac
atctatatatcacccctaaagaacccatataaaatttcagaaggtctgcctacaccgaca
aaaatgactccaagatcaagaatcttagtatcaatcggtgaatcatttgggacttcagag
aagttccagaaaataaatcaaatggtgtgtaacagcgaccgtgtgctcaaaagaagtgct
gaaggaagcaaccctcctaaaccactgaaaaaactgcgctttgacatcgaaggatccgac
gaagcagatggaagtaaacatctcccaggggaatccaaatttcaacagaaactggcagaa
atgacatctactcgaacacgaatgcaaaagcagaaaatgaatgagagcatggatacctca
aacagggaagaaaagtga

DBGET integrated database retrieval system