KEGG   Ovis aries (sheep): 100144756
Entry
100144756         CDS       T03117                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04530  Tight junction
oas04660  T cell receptor signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05212  Pancreatic cancer
oas05214  Glioma
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100144756 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100144756 (CDK4)
   04115 p53 signaling pathway
    100144756 (CDK4)
   04218 Cellular senescence
    100144756 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100144756 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100144756 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100144756 (CDK4)
   05203 Viral carcinogenesis
    100144756 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100144756 (CDK4)
   05225 Hepatocellular carcinoma
    100144756 (CDK4)
   05214 Glioma
    100144756 (CDK4)
   05220 Chronic myeloid leukemia
    100144756 (CDK4)
   05218 Melanoma
    100144756 (CDK4)
   05219 Bladder cancer
    100144756 (CDK4)
   05224 Breast cancer
    100144756 (CDK4)
   05222 Small cell lung cancer
    100144756 (CDK4)
   05223 Non-small cell lung cancer
    100144756 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100144756 (CDK4)
   04934 Cushing syndrome
    100144756 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100144756 (CDK4)
   05160 Hepatitis C
    100144756 (CDK4)
   05164 Influenza A
    100144756 (CDK4)
   05162 Measles
    100144756 (CDK4)
   05163 Human cytomegalovirus infection
    100144756 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100144756 (CDK4)
   05169 Epstein-Barr virus infection
    100144756 (CDK4)
   05165 Human papillomavirus infection
    100144756 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100144756 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    100144756 (CDK4)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100144756 (CDK4)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100144756 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 100144756
NCBI-ProteinID: NP_001120741
Ensembl: ENSOARG00000005320
UniProt: B2MVY4
LinkDB
Position
3
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
DAE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctctcgatacgagccagtggctgagattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatcctcacagtggccactttgtggccctcaagagtgtgagagtcccc
aacggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg
cggcgtctggaggcttttgagcatcccaatgttgtcaggctcatggacgtctgtgcaaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagacctc
aggacgtatctggacaaggcacccccaccaggcttgccagtggagaccataaaggatctg
atgcgccagtttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat
cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcggactgcccccggaggatgactggccccga
gatgtctctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg
gtccctgagctggaggaatccggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt
gacgcagagtga

DBGET integrated database retrieval system