Ovis aries (sheep): 100144756 Help Entry 100144756         CDS       T03117                                  Gene name CDK4 Definition (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism oas  Ovis aries (sheep) Pathway oas01522   Endocrine resistance oas04110   Cell cycle oas04115   p53 signaling pathway oas04151   PI3K-Akt signaling pathway oas04218   Cellular senescence oas04530   Tight junction oas04660   T cell receptor signaling pathway oas04933   AGE-RAGE signaling pathway in diabetic complications oas04934   Cushing syndrome oas05160   Hepatitis C oas05162   Measles oas05163   Human cytomegalovirus infection oas05164   Influenza A oas05165   Human papillomavirus infection oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05169   Epstein-Barr virus infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05212   Pancreatic cancer oas05214   Glioma oas05218   Melanoma oas05219   Bladder cancer oas05220   Chronic myeloid leukemia oas05222   Small cell lung cancer oas05223   Non-small cell lung cancer oas05224   Breast cancer oas05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100144756 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100144756 (CDK4)    04115 p53 signaling pathway     100144756 (CDK4)    04218 Cellular senescence     100144756 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     100144756 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100144756 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100144756 (CDK4)    05203 Viral carcinogenesis     100144756 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     100144756 (CDK4)    05225 Hepatocellular carcinoma     100144756 (CDK4)    05214 Glioma     100144756 (CDK4)    05220 Chronic myeloid leukemia     100144756 (CDK4)    05218 Melanoma     100144756 (CDK4)    05219 Bladder cancer     100144756 (CDK4)    05224 Breast cancer     100144756 (CDK4)    05222 Small cell lung cancer     100144756 (CDK4)    05223 Non-small cell lung cancer     100144756 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100144756 (CDK4)    04934 Cushing syndrome     100144756 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100144756 (CDK4)    05160 Hepatitis C     100144756 (CDK4)    05164 Influenza A     100144756 (CDK4)    05162 Measles     100144756 (CDK4)    05163 Human cytomegalovirus infection     100144756 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     100144756 (CDK4)    05169 Epstein-Barr virus infection     100144756 (CDK4)    05165 Human papillomavirus infection     100144756 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100144756 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:oas01001]     100144756 (CDK4) Enzymes [BR:oas01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100144756 (CDK4) Protein kinases [BR:oas01001]  Serine/threonine kinases: CMGC group   CDK family    100144756 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like Motif Other DBs NCBI-GeneID:  100144756 NCBI-ProteinID:  NP_001120741 Ensembl:  ENSOARG00000005320 UniProt:  B2MVY4 LinkDB All DBs Position 3 AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG DAE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatacgagccagtggctgagattggtgtcggtgcctatgggacagtg tacaaggcccgtgatcctcacagtggccactttgtggccctcaagagtgtgagagtcccc aacggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg cggcgtctggaggcttttgagcatcccaatgttgtcaggctcatggacgtctgtgcaaca gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagacctc aggacgtatctggacaaggcacccccaccaggcttgccagtggagaccataaaggatctg atgcgccagtttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgatcggactgcccccggaggatgactggccccga gatgtctctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg gtccctgagctggaggaatccggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt gacgcagagtga

DBGET integrated database retrieval system