KEGG   Ovis aries (sheep): 100144763
Entry
100144763         CDS       T03117                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04218  Cellular senescence
oas04310  Wnt signaling pathway
oas04340  Hedgehog signaling pathway
oas04371  Apelin signaling pathway
oas04390  Hippo signaling pathway
oas04510  Focal adhesion
oas04530  Tight junction
oas04630  JAK-STAT signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100144763 (CCND1)
   04340 Hedgehog signaling pathway
    100144763 (CCND1)
   04390 Hippo signaling pathway
    100144763 (CCND1)
   04371 Apelin signaling pathway
    100144763 (CCND1)
   04630 JAK-STAT signaling pathway
    100144763 (CCND1)
   04068 FoxO signaling pathway
    100144763 (CCND1)
   04151 PI3K-Akt signaling pathway
    100144763 (CCND1)
   04152 AMPK signaling pathway
    100144763 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100144763 (CCND1)
   04115 p53 signaling pathway
    100144763 (CCND1)
   04218 Cellular senescence
    100144763 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100144763 (CCND1)
   04530 Tight junction
    100144763 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100144763 (CCND1)
   04921 Oxytocin signaling pathway
    100144763 (CCND1)
   04919 Thyroid hormone signaling pathway
    100144763 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100144763 (CCND1)
   05206 MicroRNAs in cancer
    100144763 (CCND1)
   05205 Proteoglycans in cancer
    100144763 (CCND1)
   05203 Viral carcinogenesis
    100144763 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100144763 (CCND1)
   05212 Pancreatic cancer
    100144763 (CCND1)
   05225 Hepatocellular carcinoma
    100144763 (CCND1)
   05226 Gastric cancer
    100144763 (CCND1)
   05214 Glioma
    100144763 (CCND1)
   05216 Thyroid cancer
    100144763 (CCND1)
   05221 Acute myeloid leukemia
    100144763 (CCND1)
   05220 Chronic myeloid leukemia
    100144763 (CCND1)
   05218 Melanoma
    100144763 (CCND1)
   05219 Bladder cancer
    100144763 (CCND1)
   05215 Prostate cancer
    100144763 (CCND1)
   05213 Endometrial cancer
    100144763 (CCND1)
   05224 Breast cancer
    100144763 (CCND1)
   05222 Small cell lung cancer
    100144763 (CCND1)
   05223 Non-small cell lung cancer
    100144763 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100144763 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100144763 (CCND1)
   04934 Cushing syndrome
    100144763 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100144763 (CCND1)
   05162 Measles
    100144763 (CCND1)
   05160 Hepatitis C
    100144763 (CCND1)
   05163 Human cytomegalovirus infection
    100144763 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100144763 (CCND1)
   05169 Epstein-Barr virus infection
    100144763 (CCND1)
   05165 Human papillomavirus infection
    100144763 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100144763 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100144763
NCBI-ProteinID: XP_027815729
LinkDB
Position
21
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCVYTDNSIRPDELLHMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAAQGLHLGSANGFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggaaaccattcgccgggcgtaccccgatgcc
aacctcctcaacgaccgagtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcgtctacactgacaactccatccggcccgacgagctgctgcacatg
gagctggtcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaaaatgccggtggccgaggagaacaagcagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatttccaacccaccc
tccatggtggctgccgggagcgtggtggccgcggcgcaaggcctgcacctgggaagcgcc
aacggcttcctctcctatcaccgcctgacgcggttcctctccaaggtgatcagatgtgac
ccggactgcctccgcgcctgccaggagcagattgaagccctcctggagtccagccttcgc
caggcccagcagcagaacttggaccccaaagccgcggaggaggaggaggaagaggaggag
gtggacctggcctgcacgcccaccgacgtgcgcgacgtgaacatttga

DBGET integrated database retrieval system