KEGG   Ovis aries (sheep): 100192422
Entry
100192422         CDS       T03117                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04657  IL-17 signaling pathway
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04915  Estrogen signaling pathway
oas04926  Relaxin signaling pathway
oas05161  Hepatitis B
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05215  Prostate cancer
oas05219  Bladder cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100192422 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100192422 (MMP9)
   04670 Leukocyte transendothelial migration
    100192422 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100192422 (MMP9)
   04926 Relaxin signaling pathway
    100192422 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100192422 (MMP9)
   05202 Transcriptional misregulation in cancer
    100192422 (MMP9)
   05206 MicroRNAs in cancer
    100192422 (MMP9)
   05205 Proteoglycans in cancer
    100192422 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    100192422 (MMP9)
   05215 Prostate cancer
    100192422 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100192422 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100192422 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100192422 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    100192422 (MMP9)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     100192422 (MMP9)
Peptidases and inhibitors [BR:oas01002]
 Metallo peptidases
  Family M10
   100192422 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 DUF4953 Reprolysin_3
Other DBs
NCBI-GeneID: 100192422
NCBI-ProteinID: XP_004014663
Ensembl: ENSOARG00000007908
UniProt: A0A6P3E9E1
LinkDB
Position
13
AA seq 709 aa
MSPRQPLVLALLVLACCSAAPSPRQPTVVVFPGERRTSLTNRQLAEEYLYRYGYTPAAEL
SEDGQSLRRALLSFQRRLSLPETGELDSTTLDAMRAPRCGVPDLGGFQTFEGELKWHHHN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYP
FDGKNGLLAHAFPPGSGIQGDAHFDDEELWSLGKGVVIPTYFGNAKGAACHFPFTFEGRS
YSSCTTDGRSDDMLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFEGRTYS
ACTSDGRSDGYRWCATTANYDQDKLYGFCPTRVDATVTGGNAAGELCVFPFTFLGKEYSA
CTREGRNDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEEHPLHRDDVQGIQHLYGPRPEPEPRPPATTTAEPQPTAPPTVCVTGPPTARPS
EGPTTGPTGPPAAGPTGPPTAGPSAAPTESPDPAEDVCNVDIFDAIAEIGNRLHFFKAGK
YWKLSGGGGRRVQGPFLVKSTWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASVLGP
RRLDKLGLGPEVAQVTGALPRPGGKVLLFSGQSFWRFDVKTQKVDPQSVTPVDQMFPGVP
ISTHDIFQYQEKAYFCQDHFFWRVSSRNEVNQVDYVGYVTFDLLKCPED
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgagcccccggcagcccttggtcctggcactcctggtgctagcctgctgctctgccgcc
cccagcccacgccagcccaccgttgtggtcttcccaggagaacgacgaaccagcctcacc
aacaggcagctggcagaggaatacctgtaccgctatggctacactcctgcggcagagctg
agcgaggacggccagtccctgcggcgagctctgctgagcttccagcgccgcctgtccctg
cccgagactggcgagctggacagcaccaccctggacgccatgcgagccccgcgctgcggc
gtcccagacctgggcggattccagacctttgagggcgaactcaagtggcaccatcacaac
atcacctactggatccaaaattactcggaagacctgccgcgcgacgtgattgacgacgcc
tttgcccgcgctttcgcgctctggagcgcggtgacgccgctcacctttactcgagtatac
ggccgcgaagccgacatcgtcatccagtttggtgttagagagcacggagatgggtatccc
ttcgatggaaagaacgggctcctggcacacgcctttcctcctggctcaggcattcaggga
gatgcccacttcgacgatgaagagttatggtctctgggcaaaggcgttgtgatcccgacc
tacttcggaaacgcgaagggcgccgcctgccacttccccttcaccttcgagggccgctcc
tactcctcctgcaccacggacggccgttccgacgacatgctctggtgcagcaccaccgct
gactacgacgccgaccgccagttcggcttctgccccagcgagagactctacacccaggac
ggcaatgcggacggcaagccctgcgtcttcccgttcaccttcgagggccgcacctactcc
gcctgtacctccgatggtcgctccgacggctaccgctggtgcgccaccactgctaactac
gaccaggacaagctctacggcttctgcccgacccgagtcgatgcgacggtgaccgggggc
aacgcggcgggagagctgtgcgtcttccccttcaccttcctgggcaaggaatactcggcc
tgcaccagagagggtcgcaatgatgggcacctctggtgcgccaccacctccaacttcgac
aaagacaagaagtggggcttctgcccggatcaaggatacagcctgttccttgtggccgca
cacgagtttggccacgcgctgggcttagatcactcctccgtgccagaggcgctcatgtac
cccatgtacagattcaccgaggagcaccccctgcatagggacgatgttcagggcatccag
catctgtatggtcctcgccctgagcctgaaccacggcctccggccaccaccaccgccgaa
ccccagcccaccgctcccccaacggtctgcgtcacggggcctcccaccgcccgcccctca
gagggccccactactggccccacagggcccccggcagctggccccacgggtcctcccacg
gcaggcccttctgcggccccgacagagtccccggatccagcggaggacgtctgcaacgtg
gacatcttcgacgccatcgcggagattgggaaccgcctgcatttcttcaaggctgggaag
tactggaaactctctgggggagggggccgccgggtgcagggtccctttcttgtcaagagc
acgtggcctgcgctgccccgaaagctggactccgccttcgaggatccgctcaccaagaag
attttcttcttctctgggcgccaagtgtgggtgtacaccggcgcgtcggtgctaggcccg
aggcgtctggacaagttgggcctgggcccggaagtggcccaggtcaccggggccctcccg
cgccctgggggtaaggtgctgctgttcagcgggcagagcttctggaggttcgacgtgaag
acacagaaggtggatccccagagcgtcacccccgtggaccagatgttccccggggtgccc
attagcacgcacgacatctttcagtaccaagagaaagcttacttctgccaggatcacttc
ttctggcgtgtgagttcccggaatgaggtgaatcaggtggactatgtgggctacgtgacc
ttcgacctcctgaagtgccctgaggactag

KEGG   Ovis aries (sheep): 101120355
Entry
101120355         CDS       T03117                                 

Gene name
MMP1
Definition
(RefSeq) interstitial collagenase
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
oas  Ovis aries (sheep)
Pathway
oas03320  PPAR signaling pathway
oas04657  IL-17 signaling pathway
oas04926  Relaxin signaling pathway
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05219  Bladder cancer
oas05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101120355 (MMP1)
  09152 Endocrine system
   03320 PPAR signaling pathway
    101120355 (MMP1)
   04926 Relaxin signaling pathway
    101120355 (MMP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101120355 (MMP1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101120355 (MMP1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101120355 (MMP1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101120355 (MMP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101120355 (MMP1)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     101120355 (MMP1)
Peptidases and inhibitors [BR:oas01002]
 Metallo peptidases
  Family M10
   101120355 (MMP1)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Reprolysin_4 Reprolysin_5 DUF4953 Peptidase_M54
Other DBs
NCBI-GeneID: 101120355
NCBI-ProteinID: XP_011950698
Ensembl: ENSOARG00000005315
UniProt: A0A6P3T4Q0
LinkDB
Position
15
AA seq 466 aa
MPRLPLLLLLLWGAGSHGFPAATSEQDVETVQKYLENYYNLNSDGKKVERQRNGGLITEK
LKQMQKFFGLRVTGKPDAETLNVMKQPRCGVPDVTQFVLTPGNPRWENTNLTYRIENYTP
DLSRADVDQAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAH
AFQPGANIGGDAHFDDDERWTNDFQNYNLYRVAAHEFGHSLGLSHSTDIGALMYPSYIFS
GDVQLAQDDIDGIQAIYGPSQNPTQPVGPQTPEVCDSKLTFDAITTIRGEVMFFKDRFYM
RTNPFYADVELNFISIFWPHLPNGLHAAYEVAARDEVRFFKGNKYWAVRGQDVLRGYPRD
IYRSFGFPRTVKSIDAAVSEEDTGKTYFFVANKCWRYDEYKQSMDAGYPKMIEEDFPGIG
NKVDAVFQKGGFFYFFHGKRQYKFDPKTKRILTLLKANSWFNCRKN
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgcccagactgcctctgctgctgctgctactctggggtgcagggtcccacggcttccca
gcagcgacttcagaacaagatgtggagacggtgcagaaatacctggaaaattactacaac
ctgaacagtgatgggaagaaagttgaaaggcagagaaacggtggcctcataactgaaaag
ctgaagcaaatgcaaaaattcttcgggctgagagtgactgggaaaccagatgctgaaact
ctgaatgtgatgaagcagcccagatgtggggtgcccgacgtgactcagtttgttcttact
ccaggaaatcctcgttgggagaacacaaacttgacctacaggattgagaattacacccca
gacctgtcaagagcagatgtggaccaagccattgagaaagcctttcaactctggagcaat
gtcacacccttgaccttcaccaaggtctctgagggtcaagcggacataatgatatccttt
gtcaggggagatcatcgtgacaattctccctttgacggacctggtggaaaccttgctcat
gcttttcaaccaggtgcaaatatcggaggagacgctcattttgatgatgatgaaaggtgg
accaatgatttccaaaattataacttgtatcgggtggcagctcatgaatttggacattcc
cttggactttctcattctactgacattggggccctgatgtaccccagttacatcttcagt
ggtgatgttcagcttgctcaggatgacattgatgggatccaggccatctatggaccttcc
caaaatcctactcagccagtcggcccacaaaccccagaagtgtgtgatagcaagctaact
tttgatgctataactacaattcggggagaagtgatgttcttcaaagaccggttctacatg
cgcacaaatcccttctacgcagacgttgagctcaatttcatttctattttctggccgcat
ctcccaaatggacttcatgctgcttatgaggttgccgccagggatgaggtccggtttttc
aaaggtaacaagtactgggctgttagggggcaggatgtgctccgcggataccctagggac
atctacagatcctttggctttccaagaacggtgaagagcatcgatgctgctgtttctgag
gaagatactgggaaaacatacttctttgttgccaacaaatgctggaggtatgatgaatat
aaacagtccatggatgcaggttatcccaaaatgatagaagaagactttcctggaattggc
aacaaagttgatgctgttttccagaaaggcggatttttctacttcttccatggaaaaagg
caatacaaatttgatcccaaaactaagagaattttgactcttctaaaagctaatagctgg
ttcaactgcagaaaaaattga

KEGG   Ovis aries (sheep): 443115
Entry
443115            CDS       T03117                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase precursor
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04670  Leukocyte transendothelial migration
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04926  Relaxin signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05219  Bladder cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    443115 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    443115 (MMP2)
   04915 Estrogen signaling pathway
    443115 (MMP2)
   04926 Relaxin signaling pathway
    443115 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443115 (MMP2)
   05205 Proteoglycans in cancer
    443115 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    443115 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    443115 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    443115 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    443115 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    443115 (MMP2)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     443115 (MMP2)
Peptidases and inhibitors [BR:oas01002]
 Metallo peptidases
  Family M10
   443115 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 443115
NCBI-ProteinID: NP_001159652
Ensembl: ENSOARG00000018035
UniProt: A0A6P9FQM5 C8BKE4
LinkDB
Position
14
AA seq 661 aa
MTEARVSRGALAAPLRALCVLGCLLGPAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFRF
NGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNK
HESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTPTLGPVTPELCKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEDPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPDVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaccgaggcgcgagtgtcccggggcgcgctggccgcccctctgcgggcgctctgcgtc
ctgggctgcctgttgggccccgccgccgccgcgccatcgcccatcatcaaatttcctggc
gatgtcgcccccaaaacggacaaagagttggctgtgcaatacctaaacactttctacggc
tgccccaaggagagctgtaacttgtttgtgctgaaggacaccctgaagaagatgcagaag
ttcttcgggttaccccagacaggtgaactggaccagagcaccattgagaccatgcggaag
ccacgctgtggcaaccccgacgtggccaactacaacttcttcccccgaaagcccaagtgg
gacaagaaccagatcacatacaggatcattggctacacaccagatctggacccccagaca
gtggatgatgccttcgctcgtgccttccaagtctggagcgatgtgaccccgctacggttt
tctcggatccatgatggagaggctgacatcatgatcaactttggccgctgggaacatgga
gatgggtacccttttgatggcaaagacgggctcctggctcatgccttcgccccgggccct
ggagttgggggagactcccacttcgacgacgatgagctgtggaccctgggagaaggacaa
gtggtccgtgtcaagtacgggaatgctgacggggaatattgcaagttccccttccggttc
aacggcaaggagtacaccagctgcacagacacaggccgcagcgatggtttcctctggtgt
tccaccacatacaactttgacaaggacggcaagtatggcttctgcccccatgaagccctg
ttcaccatgggcggcaacgccgacggacagccctgcaagttcccgttccgcttccagggc
acatcttacgacagctgcaccacggagggccgtacagacggctaccgctggtgtggcacc
accgaggactacgaccgtgacaagaagtacggcttctgccccgagactgccatgtccact
gtgggcgggaactcggaaggtgccccatgtgtcttccccttcaccttcctgggcaacaag
catgagagctgcaccagcgctggccgcagtgatgggaagttgtggtgtgcgaccacctcc
aactacgatgatgaccgcaagtggggcttctgccccgaccaagggtacagcctgttcctg
gtggcagctcatgagtttggccatgcaatggggctggagcactcacaggaccctggagcc
ctgatggcgcccatttatacctatactaagaacttccgcctgtcccatgatgacatccag
ggcatccaagaactctatggggcctcccctgacattgatactggcactggccccacccca
accctcggccccgtcactcctgagctctgcaaacaggacatcgtctttgacggcatctct
cagatccgtggggagatcttcttcttcaaggaccggttcatctggcgaacagtgacacca
cgtgacaagcccacagggcccctgctagtagccacattctggcctgagctaccggaaaag
attgatgctgtgtatgaagacccacaggaggagaaggctgtgttctttgcagggaacgaa
tactgggtctattcagccagtaccctggagcgagggtaccccaagccgctgaccagcctg
gggctcccccctgatgtccagaaggtggatgctgcctttaactggagcaagaacaagaag
acatacatcttcgctggagacaaattctggagatacaatgaggtgaagaagaaaatggat
cctggcttccccaagctcatcgccgatgcctggaacgccatccctgataacctggatgct
gtggtggacctgcagggcgggggtcacagctacttcttcaagggtgcctattacctgaag
ttggagaaccaaagtctgaagagcgtgaagttcggaagcatcaaatccgattggctgggc
tgctga

DBGET integrated database retrieval system