KEGG   Ovis aries (sheep): 100216465
Entry
100216465         CDS       T03117                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04137  Mitophagy - animal
oas04141  Protein processing in endoplasmic reticulum
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04932  Non-alcoholic fatty liver disease
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05012  Parkinson disease
oas05014  Amyotrophic lateral sclerosis
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100216465 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100216465 (ATF4)
   04668 TNF signaling pathway
    100216465 (ATF4)
   04022 cGMP-PKG signaling pathway
    100216465 (ATF4)
   04151 PI3K-Akt signaling pathway
    100216465 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100216465 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100216465 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100216465 (ATF4)
   04922 Glucagon signaling pathway
    100216465 (ATF4)
   04912 GnRH signaling pathway
    100216465 (ATF4)
   04915 Estrogen signaling pathway
    100216465 (ATF4)
   04926 Relaxin signaling pathway
    100216465 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    100216465 (ATF4)
   04918 Thyroid hormone synthesis
    100216465 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100216465 (ATF4)
   04925 Aldosterone synthesis and secretion
    100216465 (ATF4)
   04927 Cortisol synthesis and secretion
    100216465 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100216465 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100216465 (ATF4)
   04728 Dopaminergic synapse
    100216465 (ATF4)
   04720 Long-term potentiation
    100216465 (ATF4)
   04722 Neurotrophin signaling pathway
    100216465 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100216465 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100216465 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100216465 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100216465 (ATF4)
   05012 Parkinson disease
    100216465 (ATF4)
   05014 Amyotrophic lateral sclerosis
    100216465 (ATF4)
   05020 Prion disease
    100216465 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    100216465 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100216465 (ATF4)
   05031 Amphetamine addiction
    100216465 (ATF4)
   05034 Alcoholism
    100216465 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100216465 (ATF4)
   04934 Cushing syndrome
    100216465 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100216465 (ATF4)
   05161 Hepatitis B
    100216465 (ATF4)
   05163 Human cytomegalovirus infection
    100216465 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    100216465 (ATF4)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100216465 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Fez1 AAA_13 Laminin_II V_ATPase_I ZapB
Other DBs
NCBI-GeneID: 100216465
NCBI-ProteinID: NP_001135990
Ensembl: ENSOARG00000016775
UniProt: B6Z9S5 A0A6P3CXA5
LinkDB
Position
3
AA seq 353 aa
MAEMSFLSSEVFVGDFVSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSCDKAKAGSSE
RLAVDGLVSFSDNSTEDAFSGTDWMVEKMDLKEFDISDTLLSIDDLETMPDELLATLDDT
CDLFDPLLQETNKEPPEIVNPIGHLPESLPTIDQGAPFTFLQPLPPSPGALSSTPDHSFS
LELCSEVVISEGDSKPDSTTSITVIPQCIKEEDAHSDNDSGICMSPDSSVGSPQHSPSTS
RGSPNKSLLSPGALSGSSRPKPYDPPGEKMVAAKVKGERLDKKLKKMEQNKTAATRYPQK
KRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKAREKKRVP
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggccgagatgagcttcctgagcagcgaggtgtttgtgggggacttcgtgtcccccttc
gaccagtcgggtttgggggctgaagagagcctaggtctcctagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctcctgcgacaaggctaaggcaggctcctccgaa
cggctggctgtggatggattggtcagtttctcagacaacagcacggaggatgctttctcc
gggacagattggatggtggagaaaatggatttgaaggagtttgatattagtgataccctg
ttgagtatagatgacctggaaaccatgccagatgagctcttggccacgttggatgacacg
tgtgatctctttgatcccctactccaggagactaacaaggagccccccgagatagtgaac
ccaattggccatcttccagaaagtttacccacaattgaccagggtgcccccttcactttc
ttgcaacctcttcccccttccccaggggccctgtcttccactccagatcattcctttagt
ttagagctatgcagtgaagtggttatctctgaaggagatagcaagccagactccaccact
tccattactgtgatccctcagtgcataaaagaggaggatgcccactcagataacgacagt
ggcatctgtatgagccctgactcctctgtgggctctccccagcatagcccctccacctcc
aggggctctccaaataagagcctgctatctccaggtgccctcagtggctcttcccgcccc
aaaccttacgaccctcctggagagaagatggtagcagcaaaagtaaagggtgagagactg
gataagaagctgaagaaaatggagcagaacaagacagcagctactaggtacccccagaag
aagagggcagaacaggaggccctcactggggaatgtaaagagctagaaaaaaagaatgag
gctctgaaagagaaggcagattccttggccaaggagatccagtatcttaaagatctgata
gaagaggttcgcaaagcaagggagaagaaaagggtcccttag

KEGG   Ovis aries (sheep): 101107485
Entry
101107485         CDS       T03117                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101107485 (CREB3L4)
   04024 cAMP signaling pathway
    101107485 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    101107485 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    101107485 (CREB3L4)
   04152 AMPK signaling pathway
    101107485 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101107485 (CREB3L4)
   04922 Glucagon signaling pathway
    101107485 (CREB3L4)
   04915 Estrogen signaling pathway
    101107485 (CREB3L4)
   04926 Relaxin signaling pathway
    101107485 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    101107485 (CREB3L4)
   04918 Thyroid hormone synthesis
    101107485 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    101107485 (CREB3L4)
   04916 Melanogenesis
    101107485 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    101107485 (CREB3L4)
   04927 Cortisol synthesis and secretion
    101107485 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101107485 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101107485 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    101107485 (CREB3L4)
   04728 Dopaminergic synapse
    101107485 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    101107485 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101107485 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101107485 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101107485 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101107485 (CREB3L4)
   05020 Prion disease
    101107485 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    101107485 (CREB3L4)
   05031 Amphetamine addiction
    101107485 (CREB3L4)
   05034 Alcoholism
    101107485 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101107485 (CREB3L4)
   04934 Cushing syndrome
    101107485 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101107485 (CREB3L4)
   05161 Hepatitis B
    101107485 (CREB3L4)
   05163 Human cytomegalovirus infection
    101107485 (CREB3L4)
   05165 Human papillomavirus infection
    101107485 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101107485 (CREB3L4)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101107485 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB OppC_N HAUS-augmin3 EMP24_GP25L
Other DBs
NCBI-GeneID: 101107485
NCBI-ProteinID: XP_012037475
Ensembl: ENSOARG00000001743
UniProt: A0A6P3TUX2
LinkDB
Position
1
AA seq 476 aa
MEKGEELRNCGVGEGESPHSPATAAPSPMPPSRTMDFSTPDLLDMCLEPPEDVFSTGSFL
ELGLHGPPSEVPVTRLQEQGLQGWECSGGHSCGLQESEPEDFLKLFIDPNQVYCSEASPG
SDSGISEDPGHPDSPPAPKPPSSPALYEVVYEAGTLERMQGEAGPAVGLISIQLGQCSLW
EGDIGPPGPVLTLQLRGFPQPMPLPRACGHPHPFSQPLTSPSDQWSPPFAVPDACVVSEL
PPDAHILPTAATVNSAPPAALQLPCQTLFLTEEEKRLLGQEGVSLPSHLPLTKAEERVLK
KVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQELQRKVQELERHNISLVTQLRQ
LQMLIVQTSNKAAQTSTCVLILLFSLALIILPSFSPFQGLPEAGPEDYQPHGVISRNILT
HRDMTENPENAVVESRLEGPPGARGANSSTRTLLEKVGGRAGPSRHIRTVLHADEM
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggaaaagggagaggagctcagaaactgtggggtgggggagggggagagccctcattct
cctgcaactgccgccccctcccccatgcctcccagcagaaccatggatttcagtacccct
gacctgctggacatgtgtctggaacctccagaagatgtcttctcaacaggatctttcctg
gagctgggactccatggtccaccttcagaggttccagtgactaggctacaggaacagggg
ctgcaaggctgggagtgcagtgggggccacagctgtggtcttcaagagagtgagcctgaa
gatttcctgaaacttttcattgaccccaatcaagtttactgctcagaagcatctcctggc
agtgacagtggaatctctgaggatcccggccatccagacagtccccctgcccccaagcca
cccagttcccctgccctctatgaggttgtctatgaggcagggaccctggagaggatgcag
ggggaagccgggccagctgtaggcctcatctccatccaactaggtcagtgttctttgtgg
gaaggggacattggccctccaggtccagtcctaaccctgcagttaagggggtttccccaa
cctatgccactgcccagagcctgtggccatccacatcctttctcccagccacttacgtct
ccctcagatcagtggagcccaccatttgcggtgcctgacgcctgcgtggtcagtgagctg
cctcctgatgctcacatcctgcccacggcagctactgtaaactcagcgcctcctgcagcc
ctgcagctgccctgtcaaactttgttcctgacagaagaggagaagcggctgctgggacag
gaaggggtttccctaccctctcacctgcccctcaccaaggcagaggagagggttctcaag
aaggtcagaaggaaaatccgtaacaagcagtcagctcaggatagccggcggcggaaaaag
gagtacattgatggcctagagagcagggtggctgcctgtgctgcacagaaccaggaacta
cagagaaaagtccaggagctagagaggcacaacatctccctggtgactcagctccgccag
ctgcagatgcttatcgttcaaacctccaacaaagctgcccagactagcacttgtgttctg
atccttcttttctccttggctctcatcatcttgcccagcttcagcccctttcagggcctg
ccagaagccgggcctgaggattaccagcctcatggagtgatttccaggaacattctgact
cacagggacatgacagagaatcctgaaaacgcagtggtagagtccagactggaggggcca
cctggggccaggggtgcaaacagctcaaccaggacactgctcgagaaggtgggagggagg
gcaggccccagcaggcacatcagaaccgtgttacatgcagatgaaatgtga

KEGG   Ovis aries (sheep): 101108743
Entry
101108743         CDS       T03117                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101108743 (CREB3L2)
   04024 cAMP signaling pathway
    101108743 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    101108743 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    101108743 (CREB3L2)
   04152 AMPK signaling pathway
    101108743 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101108743 (CREB3L2)
   04922 Glucagon signaling pathway
    101108743 (CREB3L2)
   04915 Estrogen signaling pathway
    101108743 (CREB3L2)
   04926 Relaxin signaling pathway
    101108743 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    101108743 (CREB3L2)
   04918 Thyroid hormone synthesis
    101108743 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    101108743 (CREB3L2)
   04916 Melanogenesis
    101108743 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    101108743 (CREB3L2)
   04927 Cortisol synthesis and secretion
    101108743 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101108743 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101108743 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    101108743 (CREB3L2)
   04728 Dopaminergic synapse
    101108743 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    101108743 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101108743 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101108743 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101108743 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101108743 (CREB3L2)
   05020 Prion disease
    101108743 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    101108743 (CREB3L2)
   05031 Amphetamine addiction
    101108743 (CREB3L2)
   05034 Alcoholism
    101108743 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101108743 (CREB3L2)
   04934 Cushing syndrome
    101108743 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101108743 (CREB3L2)
   05161 Hepatitis B
    101108743 (CREB3L2)
   05163 Human cytomegalovirus infection
    101108743 (CREB3L2)
   05165 Human papillomavirus infection
    101108743 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101108743 (CREB3L2)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101108743 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 101108743
NCBI-ProteinID: XP_027824652
Ensembl: ENSOARG00000009957
UniProt: A0A6P7E0P2
LinkDB
Position
4
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITASDSFNDDEVESEKWYLSPDF
PPTTIKTEPITDEPPSGLVPSVTLTITAISTPFEKEENPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSNSSDSEGSLSPSPRLHPFGLPQTHSPARAPA
RAPSALASSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
SSVVRSRNLLIYEEHSPLEEPPSSASAGELGRWDRGSALLRAKGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHMVSTNLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggagaccgaggctctcatgtaccacacgcacttctcggagcttctg
gatgagttttcccagaacgtcttgggccagctcctgaacgaccctttcctctcagagaag
agcgtgtcgatggaggtggagccgtccccgacgtccccggcacccctcatccaggccgaa
cacagctactccctatgtgaggagcctcgggcccagtcgccattcacccacatcaccgcc
agcgacagcttcaatgacgatgaagtggagagtgagaaatggtacctgtctccagacttt
ccaccaacaaccatcaagacagagcccatcacggacgagccaccctcgggacttgtcccc
tctgtcacgctgaccatcaccgcaatctccaccccgtttgaaaaggaggaaaaccctctg
gaaatgaacactggggttgattcctcatgccagaccattattcctaagattaagctggag
cctcatgaagtggatcagttcctaaacttctctcccaaggaagcctccgtggaccacctg
cacttaccacccactcctcccagcagcaacagcagcgactccgagggcagcctgagtccc
agcccgcgcctgcacccctttggccttccacagacccacagccccgccagggccccggcg
cgggccccctcggcactggccagctccccgctcctcactgctcctcataagctgcaggga
tcaggccccctggtcctgacggaggaggagaagaggaccctgatcgccgagggctacccc
atccccaccaagttgcccctgacgaaatcagaggagaaggccctaaagaaaatccggagg
aaaatcaagaataagatttcagcccaggaaagtaggaggaagaagaaagaatacatggac
agcttggagaaaaaggtagagtcttgttcaacggagaacttggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcagctgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagctggccggcacgcagactggcacatgcctc
atggtcgtggtgctgtgctttgctgtagcattcggcagcttctttcagggctatgggccc
tatccttctgccaccaagatggccctgcccagccagcattccctgcaggaaccctacaca
tcctccgtggtgagatccaggaacctgctgatctatgaggaacattctcccttggaggag
ccgcccagttctgcctcagctggggagctgggacgctgggaccgaggctctgctctgctc
agggcaaaagggctggagtccaggccagacgtggatcttcctcatttcattatctcaaat
gagaccagcctggagaaatcagtgcttttggagctgcagcagcacatggtcagcaccaac
ctggaggggaatgagacactaaaagttgtagaactcgacagaagagtgaacgccaccttt
taa

KEGG   Ovis aries (sheep): 101112976
Entry
101112976         CDS       T03117                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X2
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101112976 (CREB5)
   04024 cAMP signaling pathway
    101112976 (CREB5)
   04022 cGMP-PKG signaling pathway
    101112976 (CREB5)
   04151 PI3K-Akt signaling pathway
    101112976 (CREB5)
   04152 AMPK signaling pathway
    101112976 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101112976 (CREB5)
   04922 Glucagon signaling pathway
    101112976 (CREB5)
   04915 Estrogen signaling pathway
    101112976 (CREB5)
   04926 Relaxin signaling pathway
    101112976 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    101112976 (CREB5)
   04918 Thyroid hormone synthesis
    101112976 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    101112976 (CREB5)
   04925 Aldosterone synthesis and secretion
    101112976 (CREB5)
   04927 Cortisol synthesis and secretion
    101112976 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101112976 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101112976 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    101112976 (CREB5)
   04728 Dopaminergic synapse
    101112976 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    101112976 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101112976 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101112976 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    101112976 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101112976 (CREB5)
   05020 Prion disease
    101112976 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    101112976 (CREB5)
   05031 Amphetamine addiction
    101112976 (CREB5)
   05034 Alcoholism
    101112976 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101112976 (CREB5)
   04934 Cushing syndrome
    101112976 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101112976 (CREB5)
   05161 Hepatitis B
    101112976 (CREB5)
   05163 Human cytomegalovirus infection
    101112976 (CREB5)
   05165 Human papillomavirus infection
    101112976 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101112976 (CREB5)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101112976 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 101112976
NCBI-ProteinID: XP_014950818
UniProt: A0A6P3YLB9
LinkDB
Position
4
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNPVGGAMAGPGAHQLGSARMPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPAPTCSQQQVIQHNTITTSSAVSE
VVGSSTLSQLTTHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgcttc
ccaacagaggatcatctgatgattcataggcacaagcatgaaatgactttgaagtttccc
tcaataaaaacagacaatatgttatcagatcagactccaaccccaacgagattcctgaag
aactgcgaggaggtggggctcttcagtgagttggactgctccctagagcatgagtttagg
aaggctcaggaggaagagagcagcaagcggaatatctcgatgcataaccccgttggtggg
gccatggcggggcctggagctcaccagctcggcagcgcccggatgcccaaccatgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctctgtcatcacgcaggcc
ccttccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctccatctt
cacaacagacagagacagcccatgccagcctccatgcctgggaccctgcccaaccctaca
atgccgggttcttctgccgtcttgatgccaatggagagacaaatgtcagtgaactccaac
ctcctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaagtccagcca
atgcattcagaagctaagatgaggctgaaggctgcattgactcaccaccctgccgccatg
tcgaatgggaatatgaacaccatgggacacatgatggaaatgatgggctcccggcaggac
cagacgccgcaccatcacatgcactcacaccctcaccagcaccagacactgccggcccac
cacccctacccgcaccagcaccagcacccagcgcaccaccctcatcctcagccccatcac
cagcagaaccacccacatcatcactcccactcccaccttcacgcacacccagcacaccac
cagacctcgccacacccacccctgcactccggcaaccaagcacaggtttcaccagcaaca
caacagatgcagcccacccagacaatacagccgccccagcccacaggggggcgccggcga
agggtggtggatgaggatcctgacgagaggcggcggaaatttctggaacggaaccgggcg
gccgccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagca
gaagaactcacccagacaaacatgcagcttcagaacgaagtgtccatgttgaagaatgag
gtggcacagctgaagcagctgttgttaacacataaagactgccccataacagccatgcag
aaagagtcacaaggatatctcagtccggagagtagccctcctgcaagtcccgccccgaca
tgctcacagcagcaggtcatccagcataacaccatcaccacttcctcggcagtcagcgag
gtggtaggaagctccaccctcagccagctcaccactcacagaacagacctgaaccccatc
ctctaa

KEGG   Ovis aries (sheep): 101113586
Entry
101113586         CDS       T03117                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101113586 (CREB3L3)
   04024 cAMP signaling pathway
    101113586 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    101113586 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    101113586 (CREB3L3)
   04152 AMPK signaling pathway
    101113586 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101113586 (CREB3L3)
   04922 Glucagon signaling pathway
    101113586 (CREB3L3)
   04915 Estrogen signaling pathway
    101113586 (CREB3L3)
   04926 Relaxin signaling pathway
    101113586 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    101113586 (CREB3L3)
   04918 Thyroid hormone synthesis
    101113586 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    101113586 (CREB3L3)
   04916 Melanogenesis
    101113586 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    101113586 (CREB3L3)
   04927 Cortisol synthesis and secretion
    101113586 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101113586 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101113586 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    101113586 (CREB3L3)
   04728 Dopaminergic synapse
    101113586 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    101113586 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101113586 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101113586 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101113586 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101113586 (CREB3L3)
   05020 Prion disease
    101113586 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    101113586 (CREB3L3)
   05031 Amphetamine addiction
    101113586 (CREB3L3)
   05034 Alcoholism
    101113586 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101113586 (CREB3L3)
   04934 Cushing syndrome
    101113586 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101113586 (CREB3L3)
   05161 Hepatitis B
    101113586 (CREB3L3)
   05163 Human cytomegalovirus infection
    101113586 (CREB3L3)
   05165 Human papillomavirus infection
    101113586 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101113586 (CREB3L3)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101113586 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 ZapB KASH_CCD DUF1664
Other DBs
NCBI-GeneID: 101113586
NCBI-ProteinID: XP_004008651
Ensembl: ENSOARG00000010722
UniProt: A0A6P3E5N5 W5PM30
LinkDB
Position
5
AA seq 456 aa
MDGDLAVGKMASSTSPMGPIDSLELLDLLFDRQDGVLRHVELGEDWGHGQDQVLPGADSD
DFLNSILGSGDSDSPTWSPAASDSGISEDLPSDPQDTPPRGGVPATPASCHSVESCKGPC
PSYHPGPTCPARHLGPVAPRLETSVAIDVEMWSPGIYAEEQTDLADSPSRYNLTVKDLLL
SGSSGDLQQHHLAAPHLLRPGTGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLK
KIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKK
LQAIVVQSTSKSAQTGTCIAVLLFSFALIILPSISPFASNRAESPGDFAPVRVFSRTLHN
DAASRVAPDTAPGSEAPGPGPNTGALQERSPSSPPEEWESQDARALDNSTEDLDNSTLVQ
GNSMKELDRATLLDCAPPEPAVSPGRVGLEAAGGEL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggatggggatttagccgttggaaagatggcttcctccaccagtcccatgggccctatc
gacagcctggaactcctggatctcctgtttgaccggcaggacggcgttctgagacacgta
gagctgggagaggactggggccatgggcaggaccaggtcctgccaggtgcggactctgat
gacttcctcaactccatcctgggttctggagattcagactccccaacctggtcccccgct
gccagtgacagtggcatctcagaagatctgccctctgacccccaggacacacctccacgc
ggtggggtgcctgccacccctgccagctgccatagtgtggagtcttgcaaggggccctgc
ccgtcctaccatcctggccccacctgccctgccaggcaccttgggccagtggccccaagg
cttgagacttctgttgccatagacgtggaaatgtggagcccaggcatctatgccgaggag
cagaccgacctggctgactcgccctcacgctacaacctcacagtcaaggacctcctcctc
tctggcagcagcggggacctgcagcaacatcacctggcagccccccacctgttgcgacct
gggactgggcactgccaggagctggtgctgacggaggatgagaagaagctactagccaaa
gaaggcatcactctgcccactcagctgccccttaccaaatatgaggagcgagtgctgaaa
aagatccgccggaaaatccgaaacaaacagtcagctcaggaaagccggaaaaagaagaag
gaatacattgatggcctggagactcggatgtcagcctgcaccgcccagaatcaggagctt
cagaggaaggtcttgcatcttgaaaagcagaacctgtctctcttggaacagctgaagaaa
ctccaggccattgtggtccagtccaccagcaaatcggcacagacgggcacctgcatagca
gtcctgctcttctccttcgccctcatcatcctcccctccatcagccctttcgcctccaac
agagccgagagccccggagacttcgcacctgtgcgagttttctccagaactctacacaac
gacgctgcatctcgggtggctcccgacactgcaccaggctccgaggcccccggccccggg
cccaacactggcgcacttcaggaaaggtctccaagcagccctccggaggaatgggaatcc
caggacgcacgtgctctggacaactcgacagaggatctggacaactcaactctggtccag
ggcaactccatgaaggaactggaccgggccaccctactggactgtgccccgcctgagcca
gcagtcagcccgggccgtgtggggctggaggcagcagggggcgagctgtga

KEGG   Ovis aries (sheep): 101113882
Entry
101113882         CDS       T03117                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101113882 (CREB3L1)
   04024 cAMP signaling pathway
    101113882 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    101113882 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    101113882 (CREB3L1)
   04152 AMPK signaling pathway
    101113882 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101113882 (CREB3L1)
   04922 Glucagon signaling pathway
    101113882 (CREB3L1)
   04915 Estrogen signaling pathway
    101113882 (CREB3L1)
   04926 Relaxin signaling pathway
    101113882 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    101113882 (CREB3L1)
   04918 Thyroid hormone synthesis
    101113882 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    101113882 (CREB3L1)
   04916 Melanogenesis
    101113882 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    101113882 (CREB3L1)
   04927 Cortisol synthesis and secretion
    101113882 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101113882 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101113882 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    101113882 (CREB3L1)
   04728 Dopaminergic synapse
    101113882 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    101113882 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101113882 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101113882 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101113882 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101113882 (CREB3L1)
   05020 Prion disease
    101113882 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    101113882 (CREB3L1)
   05031 Amphetamine addiction
    101113882 (CREB3L1)
   05034 Alcoholism
    101113882 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101113882 (CREB3L1)
   04934 Cushing syndrome
    101113882 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101113882 (CREB3L1)
   05161 Hepatitis B
    101113882 (CREB3L1)
   05163 Human cytomegalovirus infection
    101113882 (CREB3L1)
   05165 Human papillomavirus infection
    101113882 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101113882 (CREB3L1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101113882 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 ELP6 Jnk-SapK_ap_N HAUS-augmin3 APG6_N TPR_MLP1_2 JMY RNase_Y_N Prominin DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 101113882
NCBI-ProteinID: XP_027835478
Ensembl: ENSOARG00000003188
UniProt: A0A6P7EWF6
LinkDB
Position
15
AA seq 609 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPVVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAMATTPLLGLSPMTRLPVAHQAPGEMTQLP
VIKAEPQEVNQFLKVTPEDLLQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTAI
STSPLLTAPHKLQGTSGPLLLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKRVRRKIKNK
ISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTSKI
SRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSIYTASQMP
SRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPVEQRPQDHLQHDHLDSTHETSKY
LSEAWPKDVGGNSTGPDFSHPKEWFHERWGSGSQHHRQALLGRAKTQDTGRTLWYSEEGS
SCSPTRIRLVPLPPGVPSQEKGFHSPPPTSPSLPQILTGAPLPPIFGLFPWANHSVLTPS
LPQPSVLLR
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggacgcggtcttggagcccttcccggccgacaggctgtttcccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttccccgagcacctg
gaccactttgcagagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggacgagaagagccctctcctggacatggaactggactcccccacgccg
ggcatccaggccgagcacagctactccctaagcggtgactcggcgcctcagagccctgtc
gtgcccatcaagatggaagacaccacccaagatgtggaacatggagcgtgggtgctgggg
cacaaactgtgctcggtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggccgcctcctcggctatggccgccgccgccatggctaccaccccgctgctgggcctc
agccccatgaccaggctgcctgtcgcccaccaggccccaggagagatgactcagctgcca
gtgatcaaagctgagccccaggaggtgaaccagttcctcaaagtgacaccagaggacctg
ttgcagatgcccccgacgccccccagcagccacggcagtgacagcgacggctcccagagt
ccccgctctctgcccccctccagccctatccggcccatggcccgctcctccacggccatc
tccacctctccactcctcaccgcccctcacaaattacaggggacgtcggggccgctgctc
ctgacggaggaggagaagcgcaccctggttgcggagggctaccccatccccaccaaactc
cccctcaccaaagccgaggagaaggccttgaagagagtccggaggaagatcaagaacaag
atctcggcccaggagagccgccgtaagaagaaggagtacgtggagtgtctagaaaagaag
gtggagacatttacatctgagaacaatgaactgtggaagaaggtggagaccctggagaat
gccaacaggactctgctccagcagctgcagaaactccagactctggtcaccagcaagatc
tccagaccttacaagatggccgccacccagacggggacctgcctcatggtggcagccctg
tgcttcgtcctggtgctgggctccctcgtgccctgcctccctgagttctcctctggctcc
cagactgtgaaggaagacccgatggccactgacagcatctacaccgccagtcagatgccc
tcccggagcctcctgttctacgacgagggagcgggctcatgggaggatggccgcagtgcc
ctgctgcccgtggagcccccggatggctgggagatcaagcccggggggccggtggagcag
cgaccccaggaccacctgcaacatgaccacctggacagcacccatgagaccagcaagtac
ctgagtgaggcctggccaaaggacgtcggtgggaacagcacgggccctgacttctcccac
cctaaggagtggttccacgagaggtggggatctgggtcccaacaccaccgtcaagctctc
ctaggccgtgccaagacccaggacacagggcgtaccctctggtactcagaagaggggtcg
tcctgctcaccaacccggatccggctcgtacccctgccccctggggtcccctcccaggag
aaagggttccactccccaccccctaccagcccctctttgccccagatcttgactggggcc
ccccttccccccatatttggactgttcccttgggccaaccactctgttctcaccccctcc
ctcccacaaccatccgtccttctcagataa

KEGG   Ovis aries (sheep): 101114243
Entry
101114243         CDS       T03117                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3 isoform X2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101114243 (CREB3)
   04024 cAMP signaling pathway
    101114243 (CREB3)
   04022 cGMP-PKG signaling pathway
    101114243 (CREB3)
   04151 PI3K-Akt signaling pathway
    101114243 (CREB3)
   04152 AMPK signaling pathway
    101114243 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101114243 (CREB3)
   04922 Glucagon signaling pathway
    101114243 (CREB3)
   04915 Estrogen signaling pathway
    101114243 (CREB3)
   04926 Relaxin signaling pathway
    101114243 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    101114243 (CREB3)
   04918 Thyroid hormone synthesis
    101114243 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101114243 (CREB3)
   04916 Melanogenesis
    101114243 (CREB3)
   04925 Aldosterone synthesis and secretion
    101114243 (CREB3)
   04927 Cortisol synthesis and secretion
    101114243 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101114243 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101114243 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    101114243 (CREB3)
   04728 Dopaminergic synapse
    101114243 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    101114243 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101114243 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101114243 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101114243 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101114243 (CREB3)
   05020 Prion disease
    101114243 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    101114243 (CREB3)
   05031 Amphetamine addiction
    101114243 (CREB3)
   05034 Alcoholism
    101114243 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101114243 (CREB3)
   04934 Cushing syndrome
    101114243 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101114243 (CREB3)
   05161 Hepatitis B
    101114243 (CREB3)
   05163 Human cytomegalovirus infection
    101114243 (CREB3)
   05165 Human papillomavirus infection
    101114243 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101114243 (CREB3)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101114243 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 101114243
NCBI-ProteinID: XP_004004321
Ensembl: ENSOARG00000011833
UniProt: A0A6P3E955
LinkDB
Position
2
AA seq 368 aa
MSHMELALDPGDRDLLGFLLEESGGLGAAPDEALASPPDWELPLSESLSDWDVEDFLSCL
PSPPSSLNVFSSSNSCLVQHDHTYSLSQEHVSIDLDNESYGKEGTQMTPLCVEEPADQEI
ARLILTEEEKRLLEKEGLTLPGMLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGG
LESRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMVIQTANKASSGSTCVLVLLFS
FCLLLVPAMYSSDTRGSLPAEHRVLSRQLRALPSEDPPQLEPPALQSEVPKDSLDHELQA
ASNSCCLFHRMPQAPRAEPPLQLPLPDSFSECSCPESISPLHANLTREEGWLPTPRPTSV
ILQGRYSG
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtctcatatggagctggcgttggacccgggtgaccgtgacctgctaggctttctgcta
gaggaaagcggtggtttgggtgcggcgcccgacgaggccttggcgtctccgccggattgg
gagctgccactttctgagtctctgagcgattgggacgtggaggatttcctgagctgcctg
ccgagtcccccatcatcgttgaacgttttcagcagctctaactcctgtcttgtccagcat
gaccacacctattctctctcacaagagcatgtctccatagatctagataatgagagctat
ggaaaagaggggactcagatgactccactgtgtgtggaggagccggcagatcaggagatt
gctaggctgatactgactgaggaggagaaaaggctgttggagaaggaggggcttactttg
cctgggatgcttccactcactaagatggaggaacaagtcctgaaacgagtgcggaggaag
attcgaaacaaaaagtctgctcaagagagccgtaggaagaagaaggtgtatgtggggggt
ttagaaagcagggtcctgaaatacacagcccagaatctggagctacagaacaaagtacag
ctcctggaggaacagaatctgtcccttttggatcagctgaggagactccaggccatggtg
attcagacagcaaacaaagccagcagcggcagcacctgtgtcttggttctactgttctcc
ttctgtctcctcctcgtacctgctatgtactcctcggacacaagggggagcctgccggct
gagcacagagtgttgtcccgtcagcttcgtgccctccccagcgaggaccccccacagctg
gagccacctgccctgcagtcagaggtaccaaaggacagcttggaccatgagctccaggct
gctagcaactcttgctgcctcttccatcgcatgccccaggctcctagagcagagcctccc
ctgcaattgccactgcctgatagtttctcagagtgctcctgcccagagtccatttctccc
ctgcatgcaaatctcacaagagaggaaggatggctccctactcccaggcccacatctgtt
atcttgcagggcagatactcaggctag

KEGG   Ovis aries (sheep): 443118
Entry
443118            CDS       T03117                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X2
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04380  Osteoclast differentiation
oas04612  Antigen processing and presentation
oas04668  TNF signaling pathway
oas04710  Circadian rhythm
oas04713  Circadian entrainment
oas04714  Thermogenesis
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04922  Glucagon signaling pathway
oas04924  Renin secretion
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04931  Insulin resistance
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas05016  Huntington disease
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05152  Tuberculosis
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05203  Viral carcinogenesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    443118 (CREB1)
   04024 cAMP signaling pathway
    443118 (CREB1)
   04022 cGMP-PKG signaling pathway
    443118 (CREB1)
   04151 PI3K-Akt signaling pathway
    443118 (CREB1)
   04152 AMPK signaling pathway
    443118 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    443118 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    443118 (CREB1)
   04922 Glucagon signaling pathway
    443118 (CREB1)
   04915 Estrogen signaling pathway
    443118 (CREB1)
   04926 Relaxin signaling pathway
    443118 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    443118 (CREB1)
   04918 Thyroid hormone synthesis
    443118 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    443118 (CREB1)
   04916 Melanogenesis
    443118 (CREB1)
   04924 Renin secretion
    443118 (CREB1)
   04925 Aldosterone synthesis and secretion
    443118 (CREB1)
   04927 Cortisol synthesis and secretion
    443118 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    443118 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    443118 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    443118 (CREB1)
   04728 Dopaminergic synapse
    443118 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    443118 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    443118 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    443118 (CREB1)
   04713 Circadian entrainment
    443118 (CREB1)
   04714 Thermogenesis
    443118 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    443118 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    443118 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    443118 (CREB1)
   05020 Prion disease
    443118 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    443118 (CREB1)
   05031 Amphetamine addiction
    443118 (CREB1)
   05034 Alcoholism
    443118 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    443118 (CREB1)
   04934 Cushing syndrome
    443118 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    443118 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    443118 (CREB1)
   05161 Hepatitis B
    443118 (CREB1)
   05163 Human cytomegalovirus infection
    443118 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    443118 (CREB1)
   05165 Human papillomavirus infection
    443118 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    443118 (CREB1)
   03029 Mitochondrial biogenesis [BR:oas03029]
    443118 (CREB1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    443118 (CREB1)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    443118 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 443118
NCBI-ProteinID: XP_004004913
Ensembl: ENSOARG00000018847
UniProt: W5QBZ9 A0A6P3E6I0
LinkDB
Position
2
AA seq 327 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPAQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagtgcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcacgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagatttcaactattgcagaaagtgaagattcacaggagtca
gtggatagtgtaaccgattcccagaaacgaagagagattctttcaaggaggccttcctac
aggaaaattctgaatgacttatcttctgatgcaccaggagtgccaaggattgaagaagag
aaatctgaagaggagacttcagcacctgccatcaccactgtcacggtgccaactccgatc
tatcagactagcagtggacagtatattgccattacccaaggaggagcaatacagctggct
aacaatggtacggatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccaggcactaccatcctgcagtatgcccagaccactgatggacagcaaatccta
gtgcccagcaaccaagttgtcgttcaagctgcctctggagatgtacagacataccagatt
cgcacagcgcccactagcaccattgcccctggggttgttatggcgtcttccccagcactt
cctgcacagcctgctgaagaagcggcgcgaaagagagaggttcgcctcatgaagaacagg
gaagcagcacgagagtgtcgtagaaagaagaaagaatatgtgaaatgtctagagaacaga
gtggcagtgcttgaaaatcaaaacaagacactgattgaggagctaaaagcacttaaggac
ctttactgccacaagtcagattaa

DBGET integrated database retrieval system