KEGG   Ovis aries (sheep): 100270717Help
Entry
100270717         CDS       T03117                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04146  Peroxisome
oas04213  Longevity regulating pathway - multiple species
oas05014  Amyotrophic lateral sclerosis (ALS)
oas05016  Huntington disease
oas05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100270717 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100270717 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100270717 (SOD1)
   05016 Huntington disease
    100270717 (SOD1)
   05020 Prion diseases
    100270717 (SOD1)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100270717 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100270717
NCBI-ProteinID: NP_001138657
Ensembl: ENSOARG00000007880
UniProt: B9VGZ6
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MATKAVCVLKGDGPVQGTIRFEAKGDKVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG
PHFNPLSKKHGGPKDEERHVGDLGNVKADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHE
RPDDLGRGGNEESTKTGNAGGRLACGVIGIAP
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaggccgtctgcgtgctgaagggtgacggcccggtgcaaggcaccatccgc
ttcgaggcaaagggagataaagtcgtcgtaactggatccattacagggctgactgaaggt
gatcatgggttccacgtccatcagtttggagacaatacacaaggctgtaccagtgcaggc
cctcactttaatcctctgtccaaaaaacacggtgggccaaaggatgaagagaggcatgtt
ggagacctgggcaatgtgaaggctgacaaaaatggtgttgccattgtggatatcgtagat
cccttgatctcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa
agaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactggaaacgctgga
ggccgtttggcctgtggtgtaattggaattgccccgtaa

DBGET integrated database retrieval system