KEGG   Ovis aries (sheep): 100271659
Entry
100271659         CDS       T03117                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04012  ErbB signaling pathway
oas04066  HIF-1 signaling pathway
oas04072  Phospholipase D signaling pathway
oas04136  Autophagy - other
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04371  Apelin signaling pathway
oas04613  Neutrophil extracellular trap formation
oas04630  JAK-STAT signaling pathway
oas04659  Th17 cell differentiation
oas04714  Thermogenesis
oas04910  Insulin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04920  Adipocytokine signaling pathway
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05014  Amyotrophic lateral sclerosis
oas05016  Huntington disease
oas05017  Spinocerebellar ataxia
oas05022  Pathways of neurodegeneration - multiple diseases
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05221  Acute myeloid leukemia
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100271659 (MTOR)
   04371 Apelin signaling pathway
    100271659 (MTOR)
   04630 JAK-STAT signaling pathway
    100271659 (MTOR)
   04066 HIF-1 signaling pathway
    100271659 (MTOR)
   04072 Phospholipase D signaling pathway
    100271659 (MTOR)
   04151 PI3K-Akt signaling pathway
    100271659 (MTOR)
   04152 AMPK signaling pathway
    100271659 (MTOR)
   04150 mTOR signaling pathway
    100271659 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100271659 (MTOR)
   04136 Autophagy - other
    100271659 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100271659 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100271659 (MTOR)
   04659 Th17 cell differentiation
    100271659 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100271659 (MTOR)
   04920 Adipocytokine signaling pathway
    100271659 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100271659 (MTOR)
   04919 Thyroid hormone signaling pathway
    100271659 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100271659 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100271659 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100271659 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100271659 (MTOR)
   05206 MicroRNAs in cancer
    100271659 (MTOR)
   05205 Proteoglycans in cancer
    100271659 (MTOR)
   05230 Central carbon metabolism in cancer
    100271659 (MTOR)
   05231 Choline metabolism in cancer
    100271659 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100271659 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100271659 (MTOR)
   05212 Pancreatic cancer
    100271659 (MTOR)
   05225 Hepatocellular carcinoma
    100271659 (MTOR)
   05226 Gastric cancer
    100271659 (MTOR)
   05214 Glioma
    100271659 (MTOR)
   05221 Acute myeloid leukemia
    100271659 (MTOR)
   05215 Prostate cancer
    100271659 (MTOR)
   05224 Breast cancer
    100271659 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100271659 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100271659 (MTOR)
   05016 Huntington disease
    100271659 (MTOR)
   05017 Spinocerebellar ataxia
    100271659 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100271659 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100271659 (MTOR)
   04931 Insulin resistance
    100271659 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100271659 (MTOR)
   05168 Herpes simplex virus 1 infection
    100271659 (MTOR)
   05163 Human cytomegalovirus infection
    100271659 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100271659 (MTOR)
   05165 Human papillomavirus infection
    100271659 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100271659 (MTOR)
   01522 Endocrine resistance
    100271659 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    100271659 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    100271659 (MTOR)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100271659 (MTOR)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100271659 (MTOR)
Membrane trafficking [BR:oas04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100271659 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 100271659
NCBI-ProteinID: NP_001138927
Ensembl: ENSOARG00000002738
UniProt: B9VXW5 A0A6P3CWS8
LinkDB
Position
12
AA seq 2550 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFRSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSSGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLVYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGYGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt   +upstreamnt  +downstreamnt
atgcttggaaccggccctgccgccgccaccacagctgccaccacatccagcaacgtgagc
gtcctgcagcagtttgccagcggcctaaagagccggaatgaagagaccagggccaaagct
gccaaggagctgcagcactacgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgatcagttgaaccatcacatctttgaactggtgtccagctcagatgcc
aatgagaggaaaggtggcattttggccatagccagcctcataggagttgaaggtgggaat
gccactcggattggaagatttgctaactaccttcggaacctccttccctccaacgaccca
gttgtcatggagatggcatccaaggccatcggtcggctcgccatggcaggggacactttc
actgctgagtatgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aacgagggccgaagacatgcagctgtcctggtgctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaatatctttgtggctgtgtgggac
cccaaacaggccatccgggagggagctgtcgccgcccttcgtgcctgtctgatcctcacc
acccagcgggagccaaaagagatgcagaagccgcagtggtacaggcacacgtttgaagaa
gcagagaaaggatttgatgagaccttggccaaggaaaagggcatgaatcgggatgaccgg
atccatggagccctgctgattctcaacgagctggtccggatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagttggtccatgacaagtactgc
aaggatctcatgggttttggaacgaaaccccgtcacatcacccccttcaccagtttccag
gccgtgcagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggattcggggcctcccccagcccggcaaagtccacgctggtggagagtcgc
tgctgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtcctgaagtgc
aggaacagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaggataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacggacagcggccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttgcctcgcgtgctggacatcatccga
gcagccctgccccctaaggacttcgcccataagagacagaaggctatgcaggtggatgcc
actgtgttcacctgcatcagcatgctggcccgagccatggggccaggcatccaacaggac
atcaaggagctgctggagcccatgctggcagtgggcctgagccctgccctcacagctgtg
ctctacgacctgagccgtcagattccgcagctgaaaaaggacatccaagatgggctgctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcttgaacagcgagcacaaggagatccgtatg
gaggccgcccgcacctgctcccgcctgctcacgccctctgtccacctcatcagtggccac
gctcatgtggtcagccagactgcagtgcaagtggtggcagatgtgctcagcaaactgctt
gtggttgggataactgatcctgaccccgacatccgctactgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacctgcaggccctgttcgtggctctg
aatgaccaggtgtttgagatccgggagctggccatttgcactgtgggccggctcagcagc
atgaacccagcctttgtcatgcccttcctgcgcaagatgctcatccagattctgacagag
ctggagcacagcggcattggaagaatcaaggagcagagtgcccgcatgctgggccacctg
gtctccaacgcaccgcgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagagttggctcaggttagtggcctcgaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctggggcagttggtggccagcaccggctacgtggtcgagccctacaggaag
taccccacgttgctggaggtgctgctgaactttctgaagactgagcagaaccagggtaca
cggcgcgaggctatccgtgtgttggggcttctaggggcactggatccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggatgcttctgccgtcagcctgtcagagtcc
aagtcaagtcaagattcttctgactacagcaccagcgagatgctggtcaacatggggaac
ctgcctctagacgagttctacccggccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccaccacaccatggtcgtccaggccatcaccttcatcttcagg
tccctggggctcaagtgcgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgggtttgtgacggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttacatggatgagatagtcacgctcatgagagaa
ttctgggtcatgaacacctccatccagagcacaatcattctcctcattgagcagattgtg
gtagccctcgggggtgaatttaagctctacctgccccagctgattccacacatgcttcgt
gtcttcatgcatgacaatagctcaggccgcatcgtctccatcaagttgctggctgcaatc
cagctgttcggtgccaacctggacgactatctgcatttgttgctgcccccgatcgtgaag
ttatttgatgcccccgaagccccattgccttctcgaaaggccgcgctagagaccgtggac
cgtctgacggagtctctggatttcacggactatgcctctcggatcattcatccgattgta
cgcacactggaccagagcccagaactccgttccacagcaatggacacattgtcttcactc
gtctttcagctgggaaagaagtaccaaattttcattccaatggtgaacaaagttctggtg
agacaccgaatcaaccatcagcgctacgacgtcctcatctgcaggatagtcaaggggtat
accctagctgacgaggaggaggaccctctggtttaccagcatcgaatgctgaggagcggc
caaggtgatgccttagccagtggaccagtggaaacagggcccatgaagaagctgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtttccaaagatgattgg
ttggaatggctgcggcggctgagcctggagctgctgaaggactcctcgtcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaatgct
gcatttgtgtcctgctggtctgagctgaatgaggaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaggacatcgcagaagtcacgcaaaccctcttaaatttg
gctgaattcatggaacacagtgacaagggccccctgcctttgagagatgacaatggcatt
gtcctgctgggcgagagggctgccaagtgccgagcatatgccaaagcgctgcactacaaa
gaactggagttccagaaaggtcccacccccgccatcctcgagtctctcatcagcattaat
aataagctgcagcagccagaggcagctgctggggtgttggagtatgccatgaagcacttt
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaagatgctctc
gtggcctatgataagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagcttcaccagcagtgctgtgaaaaa
tggactctggttaatgatgagacccaagccaagatggcccgcatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagagtacacctgtatgatccctcgggacacc
cacgatggggcattttatagagctgtgctggcactacatcaggacctcttctccttggca
caacagtgcatcgacaaagcccgggacctactggatgcagagttaacggcgatggcggga
gagagctacagccgggcctatggggccatggtttcttgccacatgctgtctgagctggag
gaggttatccagtacaaacttgtccccgagcgacgggagatcattcgccagatctggtgg
gagagactgcagggctgccagcgtatcgtggaggactggcagaaaatcctcatggtgcgg
tcactcgtcgtcagccctcatgaggacatgagaacttggctcaagtacgcaagcctgtgt
ggcaagagtggcaggctggcgcttgctcacaaaaccttagtgctactcctgggagttgat
ccatctcggcaacttgaccatcctctgccaacagttcacccccaggtgacctacgcctac
atgaaaaatatgtggaagagcgcccgcaagattgacgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcatgccattgccaccgaggaccagcagcacaag
caggagctgcacaagctcatggcccgatgtttcctgaaactcggggagtggcagctaaac
ctacagggcatcaacgagagcacgatccccaaagtcctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcatgggcagtgatgaactttgaggct
gtgctccactacaaacatcagaaccaagcccgcgatgagaagaagaagctgcgacatgcc
agtggggccaacatcactaacgcggccactgctgccaccacagcggccaccgccaccgcc
accgccaccagcactgagggcagcaacagcgagagtgaggctgagagcaccgagaacagc
cctaccccgtctcctctgcagaagaaggtcactgaggatttgtctaaaaccctcttgatg
tacactgtcccggctgtccaaggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggacacgctcagagttctcaccttatggtttgattatggtcactggccagatgta
aatgaagccttagtggaaggggtgaaagcaatccagattgacacttggttacaggttata
cctcagctcattgcaagaattgatacgccgaggcccctggtgggacgtcttatccaccag
cttctcacagacattggtcggtaccacccccaggccctcatctacccgctgacagtggcc
tccaagtccaccaccacggcccggcacaatgcagctaacaaaatcctgaagaacatgtgc
gaacacagcaacaccctggtgcagcaggccatgatggtgagtgaggagctgatccgagtg
gccatcctctggcacgagatgtggcatgaaggcctggaagaggcatctcgcttgtacttt
ggggagaggaacgtgaaaggcatgttcgaggtgctggagcccctgcacgccatgatggag
cggggaccccagacactgaaggaaacatcatttaaccaggcatatggtcgagatttaatg
gaggcccaggaatggtgcaggaagtacatgaaatcagggaacgtcaaggacctcacccaa
gcctgggacctctattaccatgtattcagacgaatctccaagcagctgcctcagctcaca
tccttagagctgcagtacgtctcccctaaacttctgatgtgccgggatctggaactggct
gtgccgggaacttatgaccccaaccagcccatcattcgcattcagtccattgcgccgtct
ctgcaagtcatcacatccaagcagaggccccggaagctgacgcttatgggcagcaacggg
cacgagtttgtcttcctcctgaagggccatgaggacctgcggcaggacgaacgggtgatg
cagcttttcggcctggtcaacacccttctggccaatgacccaacgtctcttcggaaaaac
ctcagcatccagagatacgctgtcattccattatcaaccaactcgggcctcatcggctgg
gtgccccactgtgacacgctgcacgccctcatccgggactacagggagaaaaagaagatc
cttctcaacattgagcatcgcatcatgctgcgaatggctccggactatgaccatctaact
ctgatgcagaaggtcgaggtgtttgagcacgctgtcaacaacacagctggggatgacctg
gccaaactgctgtggctgaagagccccagctctgaggtgtggtttgatcgaagaaccaat
tatacccgctctttagcggtcatgtctatggttgggtatattttgggcctgggcgataga
catccatccaacctgatgctggaccggctgagtggaaagattctgcacattgactttggg
gactgctttgaggttgctatgaccagagagaaattcccagagaagattccatttagacta
acgagaatgctgaccaatgctatggaggtcacgggccttgatggcaactacaggatcacg
tgccacaccgtgatggaggtgctccgggagcacaaggacagcgtcatggctgtgctggaa
gccttcgtctatgaccccctgctgaactggaggctgatggacacaaataccaaaggtaac
aagcgatcacggacgaggaccgattcctactctgctggccagtcagtagaaattttggat
ggtgtggaacttggggaaccagcccataagaaaacggggaccacggtgccagaatctatt
cattctttcattggatacggtttggtgaaaccagaggccctaaataagaaagctattcag
attattaacagggttcgagataaactcactggtcgggacttctctcatgacgaaaccctg
gatgtcccaacacaagtcgagctgctcatcaaacaagcgacatcccatgaaaacctctgc
cagtgctacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system