KEGG   Ovis aries (sheep): 100294600
Entry
100294600         CDS       T03117                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04015  Rap1 signaling pathway
oas04310  Wnt signaling pathway
oas04390  Hippo signaling pathway
oas04510  Focal adhesion
oas04520  Adherens junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04670  Leukocyte transendothelial migration
oas04916  Melanogenesis
oas04919  Thyroid hormone signaling pathway
oas04934  Cushing syndrome
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05100  Bacterial invasion of epithelial cells
oas05132  Salmonella infection
oas05160  Hepatitis C
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05412  Arrhythmogenic right ventricular cardiomyopathy
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100294600 (CTNNB1)
   04310 Wnt signaling pathway
    100294600 (CTNNB1)
   04390 Hippo signaling pathway
    100294600 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100294600 (CTNNB1)
   04520 Adherens junction
    100294600 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100294600 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100294600 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100294600 (CTNNB1)
   04916 Melanogenesis
    100294600 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100294600 (CTNNB1)
   05205 Proteoglycans in cancer
    100294600 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100294600 (CTNNB1)
   05225 Hepatocellular carcinoma
    100294600 (CTNNB1)
   05226 Gastric cancer
    100294600 (CTNNB1)
   05216 Thyroid cancer
    100294600 (CTNNB1)
   05217 Basal cell carcinoma
    100294600 (CTNNB1)
   05215 Prostate cancer
    100294600 (CTNNB1)
   05213 Endometrial cancer
    100294600 (CTNNB1)
   05224 Breast cancer
    100294600 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100294600 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100294600 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100294600 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100294600 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100294600 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100294600 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100294600 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100294600 (CTNNB1)
   05163 Human cytomegalovirus infection
    100294600 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100294600 (CTNNB1)
   05165 Human papillomavirus infection
    100294600 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100294600
NCBI-ProteinID: NP_001295519
Ensembl: ENSOARG00000002885
UniProt: M4WGF1 A0A6P3CYB2
LinkDB
Position
19
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGAAAPLTELLHSRNEGVATYAAAVLF
RMSEVKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGTDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgtcagtcactggcagcagcagtcttacctggactctggaatccattctggtgccact
accacagcgccttctctgagcggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggaacaggggttttctcagtccttcactcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtgagagctgccatgttccct
gagacgctagatgagggcatgcagatcccatctacacagttcgatgccgctcatcccact
aatgtccagcgtctggctgaaccatcacagatgctgaaacatgccgttgtaaacttaatt
aactaccaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgctg
aatgacgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaacacaaatgacgtggaaacagctcgctgtactgctgggaccttgcacaat
ctttcccaccatcgtgagggcttgctggccatctttaaatccgggggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattgttttatgctattacaactctccac
aaccttttactgcatcaggaaggagctaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgt
cttcagatcttagcttacggcaatcaggaaagcaagctcatcattctggctagtggtgga
cctcaagctctagtgaatataatgaggacctacacttacgagaaactactgtggaccaca
agcagagtgctgaaggtgctgtctgtgtgctctagtaacaagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcagcgccttgttcagaac
tgcctttggactctaaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctaggctcagatgatatcaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtgtgccaa
gtgggtggcatagaggcccttgtgcgcacggtcctccgtgctggggacagggaagacatc
actgagcctgccatctgtgcccttcgtcatctgaccagccggcaccaggaggctgagatg
gcccagaacgctgttcgccttcactacggactacctgtggtggttaaactcctacatcca
ccatcccactggcctctgatcaaggctactgttgggttgattcgaaaccttgccctttgt
ccagcaaatcacgcgcctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgtcgtacatctatgggtggaacacagcagcagttt
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcctattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagccgagggagccgcagctcctctg
acagaactacttcattctaggaatgagggtgtggcaacatatgcagctgctgttttgttt
cgaatgtctgaggtcaagccacaggattataagaaacggctttcagttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcac
tccggtgggtacggccaggacgccttggggacggaccccatgatggagcatgagatgggc
ggccaccaccccggtgctgactatccagttgacgggctgccagatctggggcatgcccag
gacctcatggatgggctgcccccgggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system