KEGG   Ovis aries (sheep): 100294652
Entry
100294652         CDS       T03117                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04261  Adrenergic signaling in cardiomyocytes
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04920  Adipocytokine signaling pathway
oas04922  Glucagon signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100294652 (AKT1)
   04012 ErbB signaling pathway
    100294652 (AKT1)
   04014 Ras signaling pathway
    100294652 (AKT1)
   04015 Rap1 signaling pathway
    100294652 (AKT1)
   04370 VEGF signaling pathway
    100294652 (AKT1)
   04371 Apelin signaling pathway
    100294652 (AKT1)
   04630 JAK-STAT signaling pathway
    100294652 (AKT1)
   04668 TNF signaling pathway
    100294652 (AKT1)
   04066 HIF-1 signaling pathway
    100294652 (AKT1)
   04068 FoxO signaling pathway
    100294652 (AKT1)
   04072 Phospholipase D signaling pathway
    100294652 (AKT1)
   04071 Sphingolipid signaling pathway
    100294652 (AKT1)
   04024 cAMP signaling pathway
    100294652 (AKT1)
   04022 cGMP-PKG signaling pathway
    100294652 (AKT1)
   04151 PI3K-Akt signaling pathway
    100294652 (AKT1)
   04152 AMPK signaling pathway
    100294652 (AKT1)
   04150 mTOR signaling pathway
    100294652 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100294652 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100294652 (AKT1)
   04218 Cellular senescence
    100294652 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100294652 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100294652 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100294652 (AKT1)
   04613 Neutrophil extracellular trap formation
    100294652 (AKT1)
   04620 Toll-like receptor signaling pathway
    100294652 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100294652 (AKT1)
   04660 T cell receptor signaling pathway
    100294652 (AKT1)
   04662 B cell receptor signaling pathway
    100294652 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100294652 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100294652 (AKT1)
   04062 Chemokine signaling pathway
    100294652 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100294652 (AKT1)
   04922 Glucagon signaling pathway
    100294652 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100294652 (AKT1)
   04920 Adipocytokine signaling pathway
    100294652 (AKT1)
   04929 GnRH secretion
    100294652 (AKT1)
   04915 Estrogen signaling pathway
    100294652 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100294652 (AKT1)
   04917 Prolactin signaling pathway
    100294652 (AKT1)
   04926 Relaxin signaling pathway
    100294652 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100294652 (AKT1)
   04919 Thyroid hormone signaling pathway
    100294652 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100294652 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100294652 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100294652 (AKT1)
   04728 Dopaminergic synapse
    100294652 (AKT1)
   04722 Neurotrophin signaling pathway
    100294652 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100294652 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100294652 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100294652 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100294652 (AKT1)
   05205 Proteoglycans in cancer
    100294652 (AKT1)
   05230 Central carbon metabolism in cancer
    100294652 (AKT1)
   05231 Choline metabolism in cancer
    100294652 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100294652 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100294652 (AKT1)
   05212 Pancreatic cancer
    100294652 (AKT1)
   05225 Hepatocellular carcinoma
    100294652 (AKT1)
   05226 Gastric cancer
    100294652 (AKT1)
   05214 Glioma
    100294652 (AKT1)
   05221 Acute myeloid leukemia
    100294652 (AKT1)
   05220 Chronic myeloid leukemia
    100294652 (AKT1)
   05218 Melanoma
    100294652 (AKT1)
   05211 Renal cell carcinoma
    100294652 (AKT1)
   05215 Prostate cancer
    100294652 (AKT1)
   05213 Endometrial cancer
    100294652 (AKT1)
   05224 Breast cancer
    100294652 (AKT1)
   05222 Small cell lung cancer
    100294652 (AKT1)
   05223 Non-small cell lung cancer
    100294652 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100294652 (AKT1)
   05017 Spinocerebellar ataxia
    100294652 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100294652 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100294652 (AKT1)
   04931 Insulin resistance
    100294652 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100294652 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100294652 (AKT1)
   05135 Yersinia infection
    100294652 (AKT1)
   05152 Tuberculosis
    100294652 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100294652 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100294652 (AKT1)
   05161 Hepatitis B
    100294652 (AKT1)
   05160 Hepatitis C
    100294652 (AKT1)
   05164 Influenza A
    100294652 (AKT1)
   05162 Measles
    100294652 (AKT1)
   05168 Herpes simplex virus 1 infection
    100294652 (AKT1)
   05163 Human cytomegalovirus infection
    100294652 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100294652 (AKT1)
   05169 Epstein-Barr virus infection
    100294652 (AKT1)
   05165 Human papillomavirus infection
    100294652 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100294652 (AKT1)
   05142 Chagas disease
    100294652 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100294652 (AKT1)
   01524 Platinum drug resistance
    100294652 (AKT1)
   01522 Endocrine resistance
    100294652 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    100294652 (AKT1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100294652 (AKT1)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100294652 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100294652
NCBI-ProteinID: NP_001155329
UniProt: A0A6P9FQK7 C5IJA6
LinkDB
Position
18
AA seq 480 aa
MNDVAVVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDLEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPGENSGAEEMEVSLARPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFSSIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDGMEGEDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccgtcgtgaaggagggctggctgcacaagcgaggggagtacatcaag
acctggcggccccgttacttcctcctgaagaatgatggcaccttcatcggctacaaggag
cggccgcaggacctggagcagcgcgagtcgcccctcaacaacttctctgtggcccaatgc
cagctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcacgttccacgtggagacgcccgaggagcgggaggagtggacc
accgccatccagacggtggccgatggtctcaagaggcaggaggaggagacgatggacttc
cggtcgggctcacccggcgagaactcgggggccgaggagatggaggtgtcgctggccagg
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaagacgaggtggcccacacgctcacagagaaccgc
gttctccagaactcccggcacccgttcctgacggccctgaagtactccttccagacgcac
gaccgcctgtgcttcgtcatggagtacgccaacgggggcgagctcttcttccacctgtcc
cgggagcgggtgtttcccgaggaccgggcccgcttctacggcgccgagatcgtgtcggcc
ctggattacctgcactcggagaagaacgtggtgtacagggacctcaagctcgagaacctc
atgctggacaaggacgggcacatcaagatcaccgactttggactgtgcaaggagggcatc
aaggacggcgccaccatgaagactttctgcgggacccccgagtacctggcccccgaggtg
ctggaagacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagcttttcgagctc
atcctcatggaggagatccgcttcccgcgcacactcagcccggaggccaagtccttgctc
tcggggctgctcaagaaggaccccaagcagcggcttggtgggggctctgaggacgccaag
gagatcatgcagcaccgattcttcagcagcatcgtgtggcaggacgtgtacgagaagaag
ctcagcccgcccttcaagcctcaggtcacgtctgagacggacaccaggtattttgatgag
gagttcacagcccagatgatcaccattacgccacctgaccaagacgacggcatggagggg
gaggacagcgagcggaggccgcacttcccccagttttcctactcggccagcggcacggcc
tga

KEGG   Ovis aries (sheep): 101118462
Entry
101118462         CDS       T03117                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04261  Adrenergic signaling in cardiomyocytes
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04920  Adipocytokine signaling pathway
oas04922  Glucagon signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101118462 (AKT3)
   04012 ErbB signaling pathway
    101118462 (AKT3)
   04014 Ras signaling pathway
    101118462 (AKT3)
   04015 Rap1 signaling pathway
    101118462 (AKT3)
   04370 VEGF signaling pathway
    101118462 (AKT3)
   04371 Apelin signaling pathway
    101118462 (AKT3)
   04630 JAK-STAT signaling pathway
    101118462 (AKT3)
   04668 TNF signaling pathway
    101118462 (AKT3)
   04066 HIF-1 signaling pathway
    101118462 (AKT3)
   04068 FoxO signaling pathway
    101118462 (AKT3)
   04072 Phospholipase D signaling pathway
    101118462 (AKT3)
   04071 Sphingolipid signaling pathway
    101118462 (AKT3)
   04024 cAMP signaling pathway
    101118462 (AKT3)
   04022 cGMP-PKG signaling pathway
    101118462 (AKT3)
   04151 PI3K-Akt signaling pathway
    101118462 (AKT3)
   04152 AMPK signaling pathway
    101118462 (AKT3)
   04150 mTOR signaling pathway
    101118462 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101118462 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    101118462 (AKT3)
   04218 Cellular senescence
    101118462 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101118462 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101118462 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101118462 (AKT3)
   04613 Neutrophil extracellular trap formation
    101118462 (AKT3)
   04620 Toll-like receptor signaling pathway
    101118462 (AKT3)
   04625 C-type lectin receptor signaling pathway
    101118462 (AKT3)
   04660 T cell receptor signaling pathway
    101118462 (AKT3)
   04662 B cell receptor signaling pathway
    101118462 (AKT3)
   04664 Fc epsilon RI signaling pathway
    101118462 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    101118462 (AKT3)
   04062 Chemokine signaling pathway
    101118462 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101118462 (AKT3)
   04922 Glucagon signaling pathway
    101118462 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    101118462 (AKT3)
   04920 Adipocytokine signaling pathway
    101118462 (AKT3)
   04929 GnRH secretion
    101118462 (AKT3)
   04915 Estrogen signaling pathway
    101118462 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    101118462 (AKT3)
   04917 Prolactin signaling pathway
    101118462 (AKT3)
   04926 Relaxin signaling pathway
    101118462 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    101118462 (AKT3)
   04919 Thyroid hormone signaling pathway
    101118462 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101118462 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101118462 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    101118462 (AKT3)
   04728 Dopaminergic synapse
    101118462 (AKT3)
   04722 Neurotrophin signaling pathway
    101118462 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101118462 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    101118462 (AKT3)
   04213 Longevity regulating pathway - multiple species
    101118462 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101118462 (AKT3)
   05205 Proteoglycans in cancer
    101118462 (AKT3)
   05230 Central carbon metabolism in cancer
    101118462 (AKT3)
   05231 Choline metabolism in cancer
    101118462 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101118462 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101118462 (AKT3)
   05212 Pancreatic cancer
    101118462 (AKT3)
   05225 Hepatocellular carcinoma
    101118462 (AKT3)
   05226 Gastric cancer
    101118462 (AKT3)
   05214 Glioma
    101118462 (AKT3)
   05221 Acute myeloid leukemia
    101118462 (AKT3)
   05220 Chronic myeloid leukemia
    101118462 (AKT3)
   05218 Melanoma
    101118462 (AKT3)
   05211 Renal cell carcinoma
    101118462 (AKT3)
   05215 Prostate cancer
    101118462 (AKT3)
   05213 Endometrial cancer
    101118462 (AKT3)
   05224 Breast cancer
    101118462 (AKT3)
   05222 Small cell lung cancer
    101118462 (AKT3)
   05223 Non-small cell lung cancer
    101118462 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101118462 (AKT3)
   05017 Spinocerebellar ataxia
    101118462 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101118462 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101118462 (AKT3)
   04931 Insulin resistance
    101118462 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101118462 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101118462 (AKT3)
   05135 Yersinia infection
    101118462 (AKT3)
   05152 Tuberculosis
    101118462 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101118462 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    101118462 (AKT3)
   05161 Hepatitis B
    101118462 (AKT3)
   05160 Hepatitis C
    101118462 (AKT3)
   05164 Influenza A
    101118462 (AKT3)
   05162 Measles
    101118462 (AKT3)
   05168 Herpes simplex virus 1 infection
    101118462 (AKT3)
   05163 Human cytomegalovirus infection
    101118462 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101118462 (AKT3)
   05169 Epstein-Barr virus infection
    101118462 (AKT3)
   05165 Human papillomavirus infection
    101118462 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101118462 (AKT3)
   05142 Chagas disease
    101118462 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101118462 (AKT3)
   01524 Platinum drug resistance
    101118462 (AKT3)
   01522 Endocrine resistance
    101118462 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101118462 (AKT3)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101118462 (AKT3)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101118462 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 101118462
NCBI-ProteinID: XP_027831384
Ensembl: ENSOARG00000006076
UniProt: A0A6P7ELW9
LinkDB
Position
12
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKXQ
LXKTEXPKPNTFIIRCLQWTTVIERTFHVDTPEEREEXTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaangccag
ttaangaaaacagaangaccaaagccaaacacatttattatcagatgtctccagtggacc
actgtcatagagagaacatttcacgtagatactccagaggaaagggaagaanggacagaa
gctatccaggctgtagcagacagactccagaggcaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aagagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagttattattgccaaggatgaagtggcacacactttaactgaaagcagagtatta
aagaacactagacatccctttttaacatccctgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacagattttggactttgcaaagaagggatcactgatgca
gccaccatgaagactttctgtggtacaccagagtatctggcaccagaggtgttagaagat
aatgactatggccgagctgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgtgggagattacctttctataaccaggatcatgagaaactttttgaactaattctaatg
gaagatattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggacggtatggactgcatg
gacaatgagaggcggccgcacttccctcaattttcctactctgcaagtggacgagaataa

KEGG   Ovis aries (sheep): 101119242
Entry
101119242         CDS       T03117                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04261  Adrenergic signaling in cardiomyocytes
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04728  Dopaminergic synapse
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04920  Adipocytokine signaling pathway
oas04922  Glucagon signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101119242 (AKT2)
   04012 ErbB signaling pathway
    101119242 (AKT2)
   04014 Ras signaling pathway
    101119242 (AKT2)
   04015 Rap1 signaling pathway
    101119242 (AKT2)
   04370 VEGF signaling pathway
    101119242 (AKT2)
   04371 Apelin signaling pathway
    101119242 (AKT2)
   04630 JAK-STAT signaling pathway
    101119242 (AKT2)
   04668 TNF signaling pathway
    101119242 (AKT2)
   04066 HIF-1 signaling pathway
    101119242 (AKT2)
   04068 FoxO signaling pathway
    101119242 (AKT2)
   04072 Phospholipase D signaling pathway
    101119242 (AKT2)
   04071 Sphingolipid signaling pathway
    101119242 (AKT2)
   04024 cAMP signaling pathway
    101119242 (AKT2)
   04022 cGMP-PKG signaling pathway
    101119242 (AKT2)
   04151 PI3K-Akt signaling pathway
    101119242 (AKT2)
   04152 AMPK signaling pathway
    101119242 (AKT2)
   04150 mTOR signaling pathway
    101119242 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101119242 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    101119242 (AKT2)
   04218 Cellular senescence
    101119242 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101119242 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101119242 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101119242 (AKT2)
   04613 Neutrophil extracellular trap formation
    101119242 (AKT2)
   04620 Toll-like receptor signaling pathway
    101119242 (AKT2)
   04625 C-type lectin receptor signaling pathway
    101119242 (AKT2)
   04660 T cell receptor signaling pathway
    101119242 (AKT2)
   04662 B cell receptor signaling pathway
    101119242 (AKT2)
   04664 Fc epsilon RI signaling pathway
    101119242 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    101119242 (AKT2)
   04062 Chemokine signaling pathway
    101119242 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101119242 (AKT2)
   04922 Glucagon signaling pathway
    101119242 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    101119242 (AKT2)
   04920 Adipocytokine signaling pathway
    101119242 (AKT2)
   04929 GnRH secretion
    101119242 (AKT2)
   04915 Estrogen signaling pathway
    101119242 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    101119242 (AKT2)
   04917 Prolactin signaling pathway
    101119242 (AKT2)
   04926 Relaxin signaling pathway
    101119242 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    101119242 (AKT2)
   04919 Thyroid hormone signaling pathway
    101119242 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101119242 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101119242 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    101119242 (AKT2)
   04728 Dopaminergic synapse
    101119242 (AKT2)
   04722 Neurotrophin signaling pathway
    101119242 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101119242 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    101119242 (AKT2)
   04213 Longevity regulating pathway - multiple species
    101119242 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101119242 (AKT2)
   05205 Proteoglycans in cancer
    101119242 (AKT2)
   05230 Central carbon metabolism in cancer
    101119242 (AKT2)
   05231 Choline metabolism in cancer
    101119242 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101119242 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101119242 (AKT2)
   05212 Pancreatic cancer
    101119242 (AKT2)
   05225 Hepatocellular carcinoma
    101119242 (AKT2)
   05226 Gastric cancer
    101119242 (AKT2)
   05214 Glioma
    101119242 (AKT2)
   05221 Acute myeloid leukemia
    101119242 (AKT2)
   05220 Chronic myeloid leukemia
    101119242 (AKT2)
   05218 Melanoma
    101119242 (AKT2)
   05211 Renal cell carcinoma
    101119242 (AKT2)
   05215 Prostate cancer
    101119242 (AKT2)
   05213 Endometrial cancer
    101119242 (AKT2)
   05224 Breast cancer
    101119242 (AKT2)
   05222 Small cell lung cancer
    101119242 (AKT2)
   05223 Non-small cell lung cancer
    101119242 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101119242 (AKT2)
   05017 Spinocerebellar ataxia
    101119242 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101119242 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101119242 (AKT2)
   04931 Insulin resistance
    101119242 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101119242 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101119242 (AKT2)
   05135 Yersinia infection
    101119242 (AKT2)
   05152 Tuberculosis
    101119242 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101119242 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    101119242 (AKT2)
   05161 Hepatitis B
    101119242 (AKT2)
   05160 Hepatitis C
    101119242 (AKT2)
   05164 Influenza A
    101119242 (AKT2)
   05162 Measles
    101119242 (AKT2)
   05168 Herpes simplex virus 1 infection
    101119242 (AKT2)
   05163 Human cytomegalovirus infection
    101119242 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101119242 (AKT2)
   05169 Epstein-Barr virus infection
    101119242 (AKT2)
   05165 Human papillomavirus infection
    101119242 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101119242 (AKT2)
   05142 Chagas disease
    101119242 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101119242 (AKT2)
   01524 Platinum drug resistance
    101119242 (AKT2)
   01522 Endocrine resistance
    101119242 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101119242 (AKT2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101119242 (AKT2)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101119242 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 101119242
NCBI-ProteinID: XP_027834123
UniProt: A0A6P7EV68
LinkDB
Position
14
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGADPM
DYKCGSPSDCSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRAHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccataagcgcggtgaatatatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggctataaggag
cggcctgaggcccccgaccagaccctgccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagacctcggcccaataccttcgtcattcgctgtctgcagtgg
accacagtcatcgagaggaccttccatgttgactccccggacgagagggaggagtggatg
cgggccatccagatggttgccaacagcctcaagcagcggggcccaggggcggaccccatg
gactacaagtgtggctcccccagcgactgttctgcggccgaggagatggaggtggcggtt
agcaaggcgcgggccaaggtgaccatgaatgactttgactatctcaaactcctgggcaag
ggcacctttggcaaggtcatcctggtgcgggagaaggccactggccgctactatgccatg
aagatcctgcggaaggaggtgatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgcgtcctgcagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acacacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ttgtcgcgggagcgtgtcttcacagaggagcgggcccgcttttatggcgcagagatcgtc
tcagccctggagtacctgcactcgcgggacgtagtgtaccgcgacataaagctggaaaac
ctcatgctggacaaggacggccacatcaagatcaccgacttcggcctgtgcaaggagggc
atcagcgacggggccaccatgaagactttctgtgggacgcctgagtacctggcgcccgag
gtgctggaggacaacgactacggccgggcagtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggatcacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccctaagcagaggctcggcggagggcccagcgacgcc
aaggaggtcatggagcacaggttcttcctcagtatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaagcctcaggtcacgtctgaggtcgacacaaggtactttgac
gacgagttcaccgcccagtccatcacagtcacgcccccggaccgctatgacagcctgggc
tcactggagctggaccagcgggcgcacttcccccagttctcctattcggccagcatccga
gagtga

DBGET integrated database retrieval system