KEGG   Ovis aries (sheep): 100294659
Entry
100294659         CDS       T03117                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04217  Necroptosis
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04630  JAK-STAT signaling pathway
oas04659  Th17 cell differentiation
oas04917  Prolactin signaling pathway
oas04920  Adipocytokine signaling pathway
oas04931  Insulin resistance
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas05145  Toxoplasmosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100294659 (STAT3)
   04066 HIF-1 signaling pathway
    100294659 (STAT3)
   04068 FoxO signaling pathway
    100294659 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100294659 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100294659 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100294659 (STAT3)
   04062 Chemokine signaling pathway
    100294659 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100294659 (STAT3)
   04917 Prolactin signaling pathway
    100294659 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100294659 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100294659 (STAT3)
   05206 MicroRNAs in cancer
    100294659 (STAT3)
   05205 Proteoglycans in cancer
    100294659 (STAT3)
   05203 Viral carcinogenesis
    100294659 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100294659 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100294659 (STAT3)
   05221 Acute myeloid leukemia
    100294659 (STAT3)
   05223 Non-small cell lung cancer
    100294659 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100294659 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100294659 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100294659 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    100294659 (STAT3)
   05161 Hepatitis B
    100294659 (STAT3)
   05160 Hepatitis C
    100294659 (STAT3)
   05163 Human cytomegalovirus infection
    100294659 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100294659 (STAT3)
   05169 Epstein-Barr virus infection
    100294659 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100294659 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100294659 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    100294659 (STAT3)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100294659 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 100294659
NCBI-ProteinID: XP_014954273
Ensembl: ENSOARG00000001511
UniProt: W5NTT2
LinkDB
Position
11
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggatcgagagt
caagattgggcatatgcggccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagctggaacagatgcttactgccctggaccagatgcggcgcagcattgtgagtgag
ctggcggggcttttgtcagcaatggagtatgtgcagaaaactctcacggatgaagaattg
gcagactggaagaggcgacagcagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccagcaa
attaagaaactggaggaactgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtggtggagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcagagttcaagcacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgacgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagatcgacctggagacgcactcattgcca
gtggtggtgatctccaacatctgtcagatgcccaacgcctgggcgtccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaagctcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggcaccttcctgttgagattcagtgaaagcagcaaagaaggaggagtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaaacagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccgctggtctatctctaccctgacattccaaaggag
gaggcattcggaaagtactgtcggccggagagccaggagcatcccgaagctgacccaggt
agtgctgccccatacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctgaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system