KEGG   Ovis aries (sheep): 100302080
Entry
100302080         CDS       T03117                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04014  Ras signaling pathway
oas04390  Hippo signaling pathway
oas04392  Hippo signaling pathway - multiple species
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05219  Bladder cancer
oas05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100302080 (RASSF1)
   04390 Hippo signaling pathway
    100302080 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100302080 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100302080 (RASSF1)
   05206 MicroRNAs in cancer
    100302080 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100302080 (RASSF1)
   05223 Non-small cell lung cancer
    100302080 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 100302080
NCBI-ProteinID: NP_001155349
Ensembl: ENSOARG00000016367
UniProt: C5IJA2
LinkDB
AA seq 348 aa
METRPDRAMSAEPELIELRELAPERCAAPGRTRLERANALRISPGTARNAARQQVPGRGH
RFQPAGPATHTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVSLDCCGPRDLGWEPA
LERDTNVDEPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVR
PVSVPSSKKPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRK
FLVVDDPRKFALFERAERHGQVYLRKLSDEEQPLRLRLLAGPSEKALSFVLKENDSGEVN
WDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggagacccggcccgaccgggccatgtccgctgagcctgagctcattgaattgcgggaa
ctggcacccgaacggtgcgccgccccggggcgcactcggctcgagcgtgccaatgcattg
cgcatctcgccgggcacagctcgcaacgccgcaaggcagcaggtcccgggccggggccac
cgcttccagccggcggggcccgccacgcacacgtggtgtgacctgtgtggcgacttcatc
tggggcgtcgtgcgcaagggtctgcagtgcgcgcattgcaagttcacctgccactaccgc
tgccgcgcgctcgtctccctagactgctgcgggccccgggacctgggctgggaaccggcg
ctggagcgggacacgaatgtggacgagcccgtggagtgggagacacccgacctttctcaa
gctgagatcgagcagaagatcaaggagtacaatggccagatcaacagcaacttgttcatg
agcctgaacaaggatggctcctacacaggcttcatcaaggttcagctgaagctggtgcgc
cctgtctcggttccctccagcaagaagccaccctccctgcaggatgcccggcgaggccca
gggcggggcacagctgtgaaacgccgcacctccttctacctgcccaaggatgctgtcaag
cacctgcacgtgttgtcacgcacacgggcacgtgaggtcatcgaggccctgttgcgcaaa
ttcctggtggtggatgaccctcgaaagtttgcactctttgagcgggctgagcgccatggc
caagtgtacctccggaagctgtccgatgaggagcagcccctacgcctccggctccttgca
gggcccagtgagaaggccctaagctttgtgctgaaggagaatgactctggggaggtgaat
tgggacgctttcagcatgcctgagctacacaactttctgcgcatcctgcagcgggaggaa
gaggaacacctccgccagatcctgcagaagtactcctattgtcgccagaagatccaagaa
gccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system