KEGG   Ovis aries (sheep): 100302083
Entry
100302083         CDS       T03117                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04630  JAK-STAT signaling pathway
oas04921  Oxytocin signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100302083 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100302083 (CDKN1A)
   04066 HIF-1 signaling pathway
    100302083 (CDKN1A)
   04068 FoxO signaling pathway
    100302083 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100302083 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100302083 (CDKN1A)
   04115 p53 signaling pathway
    100302083 (CDKN1A)
   04218 Cellular senescence
    100302083 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100302083 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100302083 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100302083 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100302083 (CDKN1A)
   05206 MicroRNAs in cancer
    100302083 (CDKN1A)
   05205 Proteoglycans in cancer
    100302083 (CDKN1A)
   05203 Viral carcinogenesis
    100302083 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100302083 (CDKN1A)
   05212 Pancreatic cancer
    100302083 (CDKN1A)
   05225 Hepatocellular carcinoma
    100302083 (CDKN1A)
   05226 Gastric cancer
    100302083 (CDKN1A)
   05214 Glioma
    100302083 (CDKN1A)
   05216 Thyroid cancer
    100302083 (CDKN1A)
   05220 Chronic myeloid leukemia
    100302083 (CDKN1A)
   05217 Basal cell carcinoma
    100302083 (CDKN1A)
   05218 Melanoma
    100302083 (CDKN1A)
   05211 Renal cell carcinoma
    100302083 (CDKN1A)
   05219 Bladder cancer
    100302083 (CDKN1A)
   05215 Prostate cancer
    100302083 (CDKN1A)
   05213 Endometrial cancer
    100302083 (CDKN1A)
   05224 Breast cancer
    100302083 (CDKN1A)
   05222 Small cell lung cancer
    100302083 (CDKN1A)
   05223 Non-small cell lung cancer
    100302083 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100302083 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100302083 (CDKN1A)
   05161 Hepatitis B
    100302083 (CDKN1A)
   05160 Hepatitis C
    100302083 (CDKN1A)
   05163 Human cytomegalovirus infection
    100302083 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100302083 (CDKN1A)
   05169 Epstein-Barr virus infection
    100302083 (CDKN1A)
   05165 Human papillomavirus infection
    100302083 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100302083 (CDKN1A)
   01522 Endocrine resistance
    100302083 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100302083
NCBI-ProteinID: NP_001155352
Ensembl: ENSOARG00000013636
UniProt: C5IJA7
LinkDB
Position
20
AA seq 161 aa
MSEPSRDAHQIPRSSKACRCLFGPVDSEQLRQDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPVGPRDDVGGGKRPSPSSALLQGTSQEDHLDLSLSCTLVTRS
PERPEGTPGGPGPSQGRKRRQTSMTDFYHSKRRLICSKRKP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtctgagccgtccagggacgcgcatcagatcccccgcagcagcaaggcctgccgctgc
ctctttggtccagtggacagcgagcagctgcgccaggactgcgacgccctcatggccagc
tgcgtgcaggaggcccgagagcgatggaacttcgactttgtcaccgagacgcccctggag
ggggactttgcctgggagcgtgtgaggggcctcggcctgcccaagctctacctgcccgtg
gggccccgagacgatgtgggagggggcaagcggccgagcccctcatccgccctgctgcag
ggcacgtctcaggaggaccacttggacctgtcgctgtcctgcaccctcgtgactcgctcc
cctgagcggcccgaggggacccctggtgggcctggtccctcccagggccggaaacggcgc
cagaccagcatgacagatttctaccactccaaacgcaggctgatctgctccaagaggaag
ccctaa

DBGET integrated database retrieval system