KEGG   Ovis aries (sheep): 100302100
Entry
100302100         CDS       T03117                                 

Gene name
RPA1
Definition
(RefSeq) replication protein A 70 kDa DNA-binding subunit
  KO
K07466  replication factor A1
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100302100 (RPA1)
   03420 Nucleotide excision repair
    100302100 (RPA1)
   03430 Mismatch repair
    100302100 (RPA1)
   03440 Homologous recombination
    100302100 (RPA1)
   03460 Fanconi anemia pathway
    100302100 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    100302100 (RPA1)
   03032 DNA replication proteins [BR:oas03032]
    100302100 (RPA1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    100302100 (RPA1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100302100 (RPA1)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100302100 (RPA1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100302100 (RPA1)
   MMR (mismatch excision repair)
     100302100 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100302100 (RPA1)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon IBR
Other DBs
NCBI-GeneID: 100302100
NCBI-ProteinID: NP_001155361
Ensembl: ENSOARG00000014479
UniProt: C5ISB1
LinkDB
Position
11
AA seq 616 aa
MVGHLSEGAIAAIMQQGDTSIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNPLVEEEQLSSNCICQINRFIVNTLKDGRRVVILMEVEVLKSAEAVGSKIGNPVPYNE
GHGQQPVVPPPVSAASPPTSRPQQQNGSPGVASTASKAFGASKTFGKAGGTSQVNSSGGT
QAKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSIELVDESGEIRATAFNE
QADKFFPLIDVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDGRHLPTVQF
DFTGIGDLESKSKDSLVDIIGICKNYEDVTKITVKSNNREVSKRNIYLMDMSGKVVNATL
WGDDADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTIIVNPDIPEAYKLRGWFDSEGQ
ALDGISISDLKSGGAGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQA
CPTQDCNKKVIDQQNGLYRCEKCDSEFPNFKYRMILSVNIADFQENQWVTCFQESAEAIL
GQNTAYLGELKEKNEQAFEEVFQNANFRSFTFRIRVKLETYNDESRIKATVVDVKPVDYK
EYGRRLVMNIRRNAAM
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggtgggccacctgagcgagggggccattgcggccatcatgcaacagggagatacatct
ataaaacccatcctccaagtcattaacatccgtcccattactacagggaacagtccaccc
cgttatcgactgcttatgagtgatggattgaatactctatcttctttcatgttggcaaca
cagctgaaccctcttgttgaggaagagcaattgtctagcaactgtatttgccagattaac
cgatttattgtgaacacgctgaaagatggaaggagagtggttattttgatggaggtagaa
gttttgaaatcagctgaagcagttggatcaaagattggcaatccggtaccttataatgaa
ggacacggacagcagccagtagttcctcctcctgtctcagcagccagtccaccaaccagc
aggccccagcaacagaatgggagcccaggagtggcttccactgcatctaaggcttttggt
gcctcaaagacatttggaaaagctggcggtaccagccaagtgaacagctctgggggaaca
caggccaaagtggtacccattgccagcctcaccccataccaatccaagtggactatctgt
gctcgtgtcaccaacaaaagtcaaatccgcacctggagcaactctcgaggggaaggaaag
cttttctccatagagctggttgacgagagtggtgaaatcagagcgactgctttcaatgag
caagcggacaagtttttcccccttattgacgtgaacaaggtctattacttctctaaaggc
accctgaagatcgccaacaaacaattcacagccgtcaaaaacgactacgagatgaccttc
aacaatgagacttctgtcatgccctgtgaagacggtcgtcacttacccacagttcagttt
gatttcacggggattggcgacctggagagcaaatctaaagactcgcttgtggacataatc
gggatctgcaagaactacgaagatgtcacaaaaatcacagtgaagtctaacaacagagaa
gtctcgaagagaaatatctatctgatggacatgtcagggaaggtggtgaacgctaccctg
tggggagacgatgctgataaatttgatggttctagacaacctgtgatggccatcaaagga
gccagagtttctgattttggtggacggagcctctctgtactatcttcaagcaccatcatt
gtgaaccctgacatcccagaggcctataagcttcgtggatggtttgactcagaaggacaa
gccttagatggtatttccatctctgatctaaagagtggaggagcaggtgggagcaacacc
aactggaaaactttatatgaggtcaagtcggagaacctgggccaaggtgacaagcctgac
tattttagctctgtggcaaccgtggtgtatcttcgcaaagagaactgtatgtaccaggcc
tgcccaactcaggattgtaacaagaaagtgatcgaccagcagaacggattgtaccgctgc
gagaagtgtgacagtgaattccccaacttcaagtaccgcatgatcctgtcagtcaatatt
gccgattttcaagagaatcagtgggtcacatgtttccaggagtctgcagaggccatcctt
ggacaaaacactgcgtatctcggggaattaaaagagaagaacgagcaagcatttgaggaa
gttttccagaatgccaactttcgatcttttacgttcaggatcagggtcaaactggagacc
tacaatgatgagtctcggattaaggccacggtggtggatgtgaagcctgtggactacaaa
gaatacggcagaaggctggtcatgaacatcaggaggaacgcggcgatgtga

KEGG   Ovis aries (sheep): 101105309
Entry
101105309         CDS       T03117                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  replication factor A2
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101105309 (RPA2)
   03420 Nucleotide excision repair
    101105309 (RPA2)
   03430 Mismatch repair
    101105309 (RPA2)
   03440 Homologous recombination
    101105309 (RPA2)
   03460 Fanconi anemia pathway
    101105309 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101105309 (RPA2)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101105309 (RPA2)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    101105309 (RPA2)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     101105309 (RPA2)
   MMR (mismatch excision repair)
     101105309 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     101105309 (RPA2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon
Other DBs
NCBI-GeneID: 101105309
NCBI-ProteinID: XP_012006303
Ensembl: ENSOARG00000003240
UniProt: W5NZ54
LinkDB
Position
2
AA seq 362 aa
MMAAGASGPHEIGVRVFRSLAREDRKRRRFVSTDWLKPEAFLLLIGSVLRGKEFVAPAKS
RYSAAGAAGVLRGFGEPYSGNLLELSEGIVSKMWSSGFESYSTSSFGGTGGYTQSPGGFG
SPTASQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRNAEKAAT
NIVYKIDDMTAAPMDVRQWVDTDDASGENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMP
LEDMNEFTTHILEVVNAHMMLSKSNSQPSAGRAPISNPGMGEAGNFGGNNFTPANGLTVA
QNQVLNLIKACPRPEGLNFQDLKNQLQHMSVASIKLAVDFLSNEGHIYSTVDDDHFKSTD
AE
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgatggccgccggggcttctgggcctcacgagatcggagtgcgagttttcaggagtttg
gcccgagaagacaggaaaaggcgtagattcgtgagcacagattggctgaagcccgaagcg
ttcttgttgctgattggctctgtccttcgcgggaaggagtttgtggcgccagcgaaaagc
agatacagcgcagcaggagcggcaggggtcttgagggggttcggcgaaccctacagcggg
aaccttctggaactctctgagggaatcgtgtcgaagatgtggagtagtggatttgaaagc
tatagcacctcctctttcgggggaaccggcggctacacacagtcccctgggggctttgga
tctccgacagcttcccaggccgaaaagaaatcgagagctcgagctcagcacattgtaccc
tgtaccatatcacagctgctttctgctactctggttgatgaagtattcagaattggaaac
gttgagatttcacaggtcactattgtggggattatcagaaatgcagagaaggctgcaacc
aacattgtttacaagatagatgacatgacagctgcacccatggatgttcgccagtgggtt
gacacagatgatgccagtggtgaaaacactgtggtccctccagaaacatatgtgaaagtg
gctggtcatctgagatctttccagaacaagaaaagcctggtagcctttaagatcatgccc
ctggaggatatgaatgagttcaccacacatattctggaagtagtcaatgcacacatgatg
ctgagcaagtcgaacagccagccttcagcagggagagcacctatcagcaatccaggaatg
ggtgaagctgggaacttcggtgggaataacttcacaccagcaaatggcctcactgtggcc
cagaaccaggtgctgaatttgatcaaggcttgcccaagacctgaaggattaaactttcag
gatctcaagaaccaactccagcacatgtctgtagcctcaatcaagctagctgtggatttt
ctaagcaacgagggacacatctattccaccgtggatgatgatcattttaaatccacagac
gcagaataa

KEGG   Ovis aries (sheep): 101121087
Entry
101121087         CDS       T03117                                 

Gene name
RPA3
Definition
(RefSeq) replication protein A 14 kDa subunit
  KO
K10740  replication factor A3
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101121087 (RPA3)
   03420 Nucleotide excision repair
    101121087 (RPA3)
   03430 Mismatch repair
    101121087 (RPA3)
   03440 Homologous recombination
    101121087 (RPA3)
   03460 Fanconi anemia pathway
    101121087 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101121087 (RPA3)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101121087 (RPA3)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    101121087 (RPA3)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     101121087 (RPA3)
   MMR (mismatch excision repair)
     101121087 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     101121087 (RPA3)
SSDB
Motif
Pfam: Rep_fac-A_3 DUF356
Other DBs
NCBI-GeneID: 101121087
NCBI-ProteinID: XP_027824281
Ensembl: ENSOARG00000005725
LinkDB
Position
4
AA seq 121 aa
MVDVMELPKARINASMLAQFIDQPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIVEVVGRVTAKATIMCASYVQFKEDNHPFDLGLYNEAVKITHEFPQFFPLGVVQY
G
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtggacgtgatggagttgcccaaggcgcgaatcaacgccagcatgctagctcagttc
atcgaccagccggtctgcttcgtagggaggctggagaagattcatcccactgggaaaatg
tttattctttcagatggtgaaggaaaaaatggaactattgagttgatggagcctcttgat
gaagaaatctctggaatcgtggaagtagttggaagagtaacggccaaggcaaccattatg
tgtgcatcttatgtccagtttaaagaagataatcatccttttgatcttggactttacaat
gaggctgtgaagattacccatgagttccctcagttttttcctttgggagttgtacagtat
ggttga

KEGG   Ovis aries (sheep): 105605654
Entry
105605654         CDS       T03117                                 

Gene name
RPA4
Definition
(RefSeq) LOW QUALITY PROTEIN: replication protein A 30 kDa subunit
  KO
K10741  replication factor A4
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105605654 (RPA4)
   03420 Nucleotide excision repair
    105605654 (RPA4)
   03430 Mismatch repair
    105605654 (RPA4)
   03440 Homologous recombination
    105605654 (RPA4)
   03460 Fanconi anemia pathway
    105605654 (RPA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    105605654 (RPA4)
   03400 DNA repair and recombination proteins [BR:oas03400]
    105605654 (RPA4)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    105605654 (RPA4)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     105605654 (RPA4)
   MMR (mismatch excision repair)
     105605654 (RPA4)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     105605654 (RPA4)
SSDB
Motif
Pfam: RPA_C
Other DBs
NCBI-GeneID: 105605654
NCBI-ProteinID: XP_027818929
LinkDB
Position
X
AA seq 255 aa
MSKNGFGSYGSISAPGXASGSSDPLSQGRVALATKSMGSRXQIQAIVPCVNQLLTSTLVD
NIFKTRGIKISQVSVVGIIRQAEKTASYXHKICDRTIKPIEVCQWVGRDKAKQEVTLLPV
GVYAKVFGILKCSVEVKSLEMLKIHVLQDKNEYSTHIIXKWSRYMMLDNTXQNGPVDPSE
RGEAQKHGEHHPSFVQNEVLHLIREHPPXEGKSIPELQTKLCDLSIWTVKQAINYLTVEG
HIYPTVDEEHFKSAD
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagtaagaatgggtttgggagctatggcagcatttctgccccaggtnaggccagcgga
agcagtgacccactgtctcagggcagggtagctcttgctactaagtccatgggatccagg
ngccaaatccaggctattgttccttgtgtaaaccaactgctcacctccactctggttgat
aacatcttcaagactagaggaatcaagatttcccaagtttctgttgtgggaataataagg
caggcagagaagactgcaagttacnttcacaagatttgcgataggaccattaaacctatt
gaggtctgccagtgggttggcagagataaagcaaagcaggaggtgactctgcttccagtg
ggagtatatgccaaagtgtttggtatcttgaaatgttctgtggaggtgaagagccttgag
atgttgaaaatccatgtcctccaggacaagaatgagtacagcacacacataatctagaaa
tggtcaaggtacatgatgctggataacaccnggcaaaatggccctgttgatccatcagaa
aggggtgaggcccagaagcacggcgagcaccaccccagtttcgtccagaatgaggtgctg
catttgattcgtgagcatcctccataggaaggcaagagcattcctgagctccagaccaag
ctttgtgacctgagcatctggaccgtcaagcaagccattaattatctgaccgtggagggc
cacatctaccccactgtggatgaagagcatttcaaatctgctgattga

DBGET integrated database retrieval system