KEGG   Ovis aries (sheep): 100302345Help
Entry
100302345         CDS       T03117                                 

Gene name
NANOG
Definition
(RefSeq) homeobox protein NANOG isoform X1
  KO
K10164  homeobox protein Nanog
Organism
oas  Ovis aries (sheep)
Pathway
oas04550  Signaling pathways regulating pluripotency of stem cells
oas05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100302345 (NANOG)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100302345 (NANOG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    100302345 (NANOG)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    100302345 (NANOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain TFIIF_alpha
Motif
Other DBs
NCBI-GeneID: 100302345
NCBI-ProteinID: XP_004006950
Ensembl: ENSOARG00000002216
LinkDB All DBs
Position
3
AA seq 300 aa AA seqDB search
MSVDPACPQSLLGPEASNSGESSPMPEESYASLQMSSADTLDTDTVSPLPSSMDLLIQDS
PDSSTSPRVKPLSPSAEESTEKEEKVPVKKQKIRTVFSQTQLCVLNDRFQRQKYLSLQQM
QELSNILNLSYKQVKTWFQNQRMKCKKWQKNNWPRNSNGVPQGPATAEYPGFYSYHQGCL
VNSPGNLPMWGNQTWNNPTWSNQSWNSQSWSNHSWNSQAWCPQAWNNQPWNNQFNNYMEE
FLQPGIQLQQNSPVCDLEATLGTAGENYNIIQQTVKYFSSQQQITDLFPNYPLNIQPEDL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggacccagcttgtccccaaagcctgcttggccccgaagcatccaactctggg
gaatcttcacccatgcctgaagaaagttacgcgtccttgcaaatgtcatctgctgacacc
ctcgacacggacactgtctctcctcttccttcctccatggatctgcttattcaggacagt
cctgattcttccacaagccccagagtgaaaccactgtccccatctgcagaggagagcaca
gagaaggaagagaaggtccccgtcaagaaacaaaagatcagaactgtgttctcacagacc
cagttgtgtgtgctcaatgacagatttcagaggcagaaatacctcagtctccagcaaatg
caagaactttccaacatcttgaacctcagctacaagcaggtgaagacctggttccagaat
cagagaatgaaatgtaagaaatggcagaaaaacaactggccgaggaatagcaatggtgtg
cctcagggcccagcaacagcagaatacccgggcttctattcctaccatcaggggtgtttg
gtgaactctcctggaaacctgcccatgtggggtaaccagacctggaataaccccacgtgg
agcaatcagagctggaacagtcagtcttggagcaaccactcctggaacagtcaggcctgg
tgcccccaagcctggaataaccagccttggaacaatcagttcaacaactacatggaggaa
ttcctgcagccagggatccagctccagcagaattcccccgtctgtgatctggaggccacc
ctgggaactgctggggaaaattataacataatacagcaaactgtcaagtatttcagttcc
cagcagcaaatcactgatttattcccaaactaccctctcaacatacagcctgaagatttg
taa

DBGET integrated database retrieval system