KEGG   Ovis aries (sheep): 100302501
Entry
100302501         CDS       T03117                                 

Gene name
PLAU
Definition
(RefSeq) urokinase-type plasminogen activator precursor
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
oas  Ovis aries (sheep)
Pathway
oas04064  NF-kappa B signaling pathway
oas04610  Complement and coagulation cascades
oas05202  Transcriptional misregulation in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100302501 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100302501 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100302501 (PLAU)
   05206 MicroRNAs in cancer
    100302501 (PLAU)
   05205 Proteoglycans in cancer
    100302501 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    100302501 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    100302501 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    100302501 (PLAU)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     100302501 (PLAU)
Peptidases and inhibitors [BR:oas01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100302501 (PLAU)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100302501 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle Trypsin_2 DUF316
Other DBs
NCBI-GeneID: 100302501
NCBI-ProteinID: NP_001157065
Ensembl: ENSOARG00000008473
UniProt: A0A6P3CX13 C6GBR3
LinkDB
Position
25
AA seq 433 aa
MRVLLACLLVCALVVSDSDGSNEVHKESGVSDCGCLNGGKCVSYKYFSNIQRCSCPKKFQ
GEYCEIDTSKTCYQGNGHSYRGKANTDLRGRPRLAWDSATVLLKMYHAHRSDAIQLGLGK
HNYCRNPDNQRRPWCYVQVGLKQFVQECMVQDCPAGKGPSSPKEKVEFQCGQKALRPRFE
IVGGEFTTIESQPWFAAIYRRHRGGSVTYLCGGSLISPCWVVSATHCFTNHPKKEDYIVY
LGRSKLNSDTLGEMKFEVEKLILHEDYSADSLAHHNDIALLKIRTSRGQCAQPSRSIQTI
CLPPLYGDARFGTRCEITGFGKENPSDYLYPEQLKMTFVNLVSHEECQQPHYYGTEVTDK
MLCAADPQWETDSCQGDSGGPLVCTIQGRLTLTGIVSWGRECAMKDKPGVYTRVSKFLPW
IYTHTRGEIDLGL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagggtcctgttggcatgcctgctcgtctgtgccctggtcgtgagcgactctgatggc
agcaatgaagttcataaagagtctggtgtatcggactgtggctgtctgaacggaggaaaa
tgtgtgtcctacaagtacttctccaacattcagcgatgcagttgcccaaagaaattccaa
ggggaatactgtgagatagatacatcaaaaacctgctatcaggggaatggtcactcttac
cgagggaaggccaacacagacctcagaggccggccccgcctggcctgggactctgccacc
gtccttctgaaaatgtaccatgcccacagatctgatgccattcagctgggcctggggaaa
cacaattattgcaggaacccagacaatcagagaaggccctggtgctatgtgcaggttggc
ctaaagcagtttgtccaggagtgcatggtgcaggactgccctgctggaaaaggtccctcc
tctcctaaggagaaagtagagttccaatgtggccagaaggctctgaggcctcgctttgag
attgttgggggagagttcaccaccatcgagagccagccttggtttgcagccatctatagg
agacatcggggaggctctgttacctacttgtgcggtggcagcctcatcagtccctgctgg
gtggtcagcgccacacactgcttcactaatcacccaaagaaggaggactacattgtctac
ctgggtcgttcaaagcttaactctgacacgcttggggagatgaagtttgaggtggaaaag
ctcatcttgcatgaggactacagtgcagacagccttgctcaccacaacgatattgccttg
ctgaagatccgtaccagcagaggccaatgtgcacagccctcccggtccatacaaaccatc
tgcctgcccccactatatggagatgcccgttttggcacaaggtgtgagatcactggcttc
ggaaaagagaatccctctgactatctctacccagagcagctgaaaatgacttttgtgaat
ctggtttcccatgaggaatgtcagcagccccactactatggcactgaagtcactgacaaa
atgctgtgtgcggctgacccacagtgggaaacagattcctgccagggagactcaggaggc
ccgctggtctgtaccatccaaggccgcctgaccctgactgggattgtgagctggggccgt
gaatgtgccatgaaggacaagccaggagtctacacaagggtctcaaaattcctgccctgg
atctacactcacaccaggggagagattgaccttggcctgtga

DBGET integrated database retrieval system