KEGG   Ovis aries (sheep): 100305131
Entry
100305131         CDS       T03117                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04068  FoxO signaling pathway
oas04270  Vascular smooth muscle contraction
oas04650  Natural killer cell mediated cytotoxicity
oas04720  Long-term potentiation
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04928  Parathyroid hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05034  Alcoholism
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100305131 (ARAF)
   04012 ErbB signaling pathway
    100305131 (ARAF)
   04068 FoxO signaling pathway
    100305131 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100305131 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100305131 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100305131 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    100305131 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100305131 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100305131 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100305131 (ARAF)
   04720 Long-term potentiation
    100305131 (ARAF)
   04730 Long-term depression
    100305131 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100305131 (ARAF)
   05205 Proteoglycans in cancer
    100305131 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100305131 (ARAF)
   05212 Pancreatic cancer
    100305131 (ARAF)
   05225 Hepatocellular carcinoma
    100305131 (ARAF)
   05226 Gastric cancer
    100305131 (ARAF)
   05214 Glioma
    100305131 (ARAF)
   05221 Acute myeloid leukemia
    100305131 (ARAF)
   05220 Chronic myeloid leukemia
    100305131 (ARAF)
   05218 Melanoma
    100305131 (ARAF)
   05211 Renal cell carcinoma
    100305131 (ARAF)
   05219 Bladder cancer
    100305131 (ARAF)
   05215 Prostate cancer
    100305131 (ARAF)
   05213 Endometrial cancer
    100305131 (ARAF)
   05224 Breast cancer
    100305131 (ARAF)
   05223 Non-small cell lung cancer
    100305131 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100305131 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100305131 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    100305131 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100305131 (ARAF)
   05160 Hepatitis C
    100305131 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100305131 (ARAF)
   01522 Endocrine resistance
    100305131 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    100305131 (ARAF)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100305131 (ARAF)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100305131 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 100305131
NCBI-ProteinID: NP_001159362
Ensembl: ENSOARG00000013254
UniProt: A0A6P3CXM2 C7BDX3
LinkDB
Position
X
AA seq 606 aa
MEPPRGPPANGAEPSRSVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGSSRQHEVPSNRPLNEPL
TPQSPSSCTQHRDPEHFSFPAQANTPLQRIRSTSTPNVHMVSTTAPMDSGLIQLTGQNFN
TDAAGNRGGGDGAPRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgctaacggggccgagccctcccggtcagtgggcacc
gtcaaagtgtacctgcccaacaagcagcgcacggtggtgactgtccgggacggcatgagt
gtctatgactctctagacaaggccctcaaggtgcggggtctcaatcaagattgctgtgtg
gtttaccggctcatcaaggggcgaaagacagtcactgcctgggacacagccattgccccg
ctggatggcgaggagctcattgtggaggtcctcgaagacgtccccctgaccatgcacaat
tttgtacggaagacattcttcagcctggccttttgtgacttctgccttaagtttctgttc
catggtttccgctgccaaacctgtggatacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgtcgacatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccggaagctccagacagcacgaggttccctcaaaccgccccctgaatgagccgctc
acccctcagagtcccagctcctgcacccagcaccgcgaccccgagcacttctccttccct
gcccaggccaacacccccctccagcgcatccgctccacatccacccccaatgtccacatg
gtcagcaccacagcccccatggactccggcctcatccagctcactggccagaacttcaac
actgatgctgctgggaatagaggtggtggcgatggagccccccgggggagccccagccca
gccagcgtgtcctcgggaaggaagtccccacattccaagtccccatcagagcagcgggaa
cggaagtccttggctgatgacaagaagaaagtgaagaatttggggtaccgggactcgggc
tattactgggaggtgccacccagtgaggtgcagttgctgaagaggatcgggacgggctcg
tttggcacggtgtttcgcgggcggtggcatggcgatgtggccgtgaaggtgctcaaggtg
gcccaacccacagctgagcaggcccaggccttcaagaacgagatgcaggtgctcaggaag
acacgtcacgtcaacatcttgctgttcatgggcttcatgacccggccaggatttgccatc
atcacacagtggtgtgagggctccagtctctaccaccacctgcatgtggctgacacacgc
ttcgacatggtccagctcattgatgtggcccgccagactgctcagggcatggactacctc
catgccaagaacatcatccaccgagatctcaagtctaacaacatcttcctgcacgagggg
ctcacggtgaagatcggggattttggcctggccacagtaaagacgcggtggagtggggcc
cagcccttggagcaaccctcaggctctgtgctatggatggcagctgaggtgatccgtatg
caggacccgaacccctacagcttccagtcagatgtctacgcctatggggttgtgctctat
gagctcatgaccggctcactgccttacagccacattggcagccgagaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaattgccccaag
gccatgaggcgcctgctgtctgactgcctgaagttccagcgagaggagcggccccttttt
ccccagatcctggccacgattgagctgctgcagcggtcactccccaagattgagcggagt
gcctccgaaccctccttgcaccgtacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgccttgtgccttag

KEGG   Ovis aries (sheep): 101103190
Entry
101103190         CDS       T03117                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04218  Cellular senescence
oas04270  Vascular smooth muscle contraction
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04613  Neutrophil extracellular trap formation
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04929  GnRH secretion
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05034  Alcoholism
oas05132  Salmonella infection
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101103190 (RAF1)
   04012 ErbB signaling pathway
    101103190 (RAF1)
   04014 Ras signaling pathway
    101103190 (RAF1)
   04015 Rap1 signaling pathway
    101103190 (RAF1)
   04370 VEGF signaling pathway
    101103190 (RAF1)
   04371 Apelin signaling pathway
    101103190 (RAF1)
   04630 JAK-STAT signaling pathway
    101103190 (RAF1)
   04068 FoxO signaling pathway
    101103190 (RAF1)
   04072 Phospholipase D signaling pathway
    101103190 (RAF1)
   04071 Sphingolipid signaling pathway
    101103190 (RAF1)
   04024 cAMP signaling pathway
    101103190 (RAF1)
   04022 cGMP-PKG signaling pathway
    101103190 (RAF1)
   04151 PI3K-Akt signaling pathway
    101103190 (RAF1)
   04150 mTOR signaling pathway
    101103190 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101103190 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    101103190 (RAF1)
   04218 Cellular senescence
    101103190 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101103190 (RAF1)
   04540 Gap junction
    101103190 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101103190 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101103190 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101103190 (RAF1)
   04625 C-type lectin receptor signaling pathway
    101103190 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    101103190 (RAF1)
   04660 T cell receptor signaling pathway
    101103190 (RAF1)
   04662 B cell receptor signaling pathway
    101103190 (RAF1)
   04664 Fc epsilon RI signaling pathway
    101103190 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    101103190 (RAF1)
   04062 Chemokine signaling pathway
    101103190 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101103190 (RAF1)
   04929 GnRH secretion
    101103190 (RAF1)
   04912 GnRH signaling pathway
    101103190 (RAF1)
   04915 Estrogen signaling pathway
    101103190 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    101103190 (RAF1)
   04917 Prolactin signaling pathway
    101103190 (RAF1)
   04921 Oxytocin signaling pathway
    101103190 (RAF1)
   04926 Relaxin signaling pathway
    101103190 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    101103190 (RAF1)
   04919 Thyroid hormone signaling pathway
    101103190 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    101103190 (RAF1)
   04916 Melanogenesis
    101103190 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101103190 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    101103190 (RAF1)
   04720 Long-term potentiation
    101103190 (RAF1)
   04730 Long-term depression
    101103190 (RAF1)
   04722 Neurotrophin signaling pathway
    101103190 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    101103190 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101103190 (RAF1)
   05206 MicroRNAs in cancer
    101103190 (RAF1)
   05205 Proteoglycans in cancer
    101103190 (RAF1)
   05230 Central carbon metabolism in cancer
    101103190 (RAF1)
   05231 Choline metabolism in cancer
    101103190 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101103190 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101103190 (RAF1)
   05212 Pancreatic cancer
    101103190 (RAF1)
   05225 Hepatocellular carcinoma
    101103190 (RAF1)
   05226 Gastric cancer
    101103190 (RAF1)
   05214 Glioma
    101103190 (RAF1)
   05221 Acute myeloid leukemia
    101103190 (RAF1)
   05220 Chronic myeloid leukemia
    101103190 (RAF1)
   05218 Melanoma
    101103190 (RAF1)
   05211 Renal cell carcinoma
    101103190 (RAF1)
   05219 Bladder cancer
    101103190 (RAF1)
   05215 Prostate cancer
    101103190 (RAF1)
   05213 Endometrial cancer
    101103190 (RAF1)
   05224 Breast cancer
    101103190 (RAF1)
   05223 Non-small cell lung cancer
    101103190 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101103190 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101103190 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    101103190 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101103190 (RAF1)
   05152 Tuberculosis
    101103190 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101103190 (RAF1)
   05161 Hepatitis B
    101103190 (RAF1)
   05160 Hepatitis C
    101103190 (RAF1)
   05164 Influenza A
    101103190 (RAF1)
   05163 Human cytomegalovirus infection
    101103190 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101103190 (RAF1)
   05165 Human papillomavirus infection
    101103190 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101103190 (RAF1)
   01522 Endocrine resistance
    101103190 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101103190 (RAF1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101103190 (RAF1)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101103190 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 101103190
NCBI-ProteinID: XP_004018591
Ensembl: ENSOARG00000015630
UniProt: A0A6P3EIX5 W5Q234
LinkDB
Position
19
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGASCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDGGVPALPSLTMRRMRESVSRIPPGSQHRYSTPHAFTF
STSSPSSEGSLSQRQRSTSTPNVHMVSAALPVDSRMIEDAIRSHSESGSPSALSSSPNNL
SPTGWSQPKTPAPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggcgcctggaagacgatcagcaacggttttggattcaaagacacg
gtgtttgacggcgccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcgtcagatgatggcaagcttacggacccttctaagacaagcaacactatccgtgtg
tttttgccaaacaagcaaagaacagtggtcaacgtacggaatggaatgagcttgcatgac
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacggttagattggaatactgatgctgcctcg
ttgattggagaggaacttcaagtggatttcctggatcatgttcccctcacaacacacaac
tttgctcggaaaaccttcctgaagcttgccttctgtgacatctgtcagaagttcttgctg
aatggatttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cccactatgtgtgtggactggagtaatatcagacagctcttattgttcccaaattccact
gttggtgatggcggggtcccagcgctgccttctttgacgatgcgtcggatgcgagagtct
gtttcccggatacctcctggttcccagcacagatactccacaccccacgctttcacattc
agcacctccagcccctcctctgaaggctccctctcccagaggcagaggtcgacgtctacg
ccaaacgtgcacatggtcagcgccgctctgcccgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcaggctccccttcagccttgtccagcagccccaacaatctg
agcccgacaggctggtcacagcccaaaacccctgcgcctgcgcagagagagcgggcgcca
ggctccagcacccaggagaagaacaaaattaggcctcgtggacaaagagattcgagctat
tactgggagatagaagccagtgaagtgatgctgtccactcggattggatcaggctccttc
gggactgtttataagggcaagtggcatggagatgttgcagtaaagattctgaaggttgtt
gaccccactccagagcagttccaggccttcaggaacgaggtggctgtcctccgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcgatcgtg
acgcagtggtgcgagggcagcagcctctacaagcacctgcatgtccaggagaccaagttc
cagatgttccagctgatcgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaataatatatttctccacgaaggccta
acggtgaaaatcggcgattttggattggccacggtgaagtcgcgctggagtggttctcag
caggtcgagcagcccaccggctccatcctgtggatggccccagaggtgatccggatgcag
gataataacccgttcagcttccagtctgacgtctactcctacggcatcgtgctgtatgag
ctcatgacgggggagctcccttactcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgcgggtacgcctccccagacctcagcaagctgtacaagaactgccccaaagcc
atgaagaggctggtagccgactgtgtgaagaaagtgaaggaagagaggcctctttttccc
cagatcctgtcttccatcgagctgctccagcactctctgcccaagatcaaccggagcgcc
tcggagccctccctgcaccgggcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcccctcggctgcccgtcttttag

KEGG   Ovis aries (sheep): 101107438
Entry
101107438         CDS       T03117                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X2
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04068  FoxO signaling pathway
oas04150  mTOR signaling pathway
oas04270  Vascular smooth muscle contraction
oas04510  Focal adhesion
oas04650  Natural killer cell mediated cytotoxicity
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05034  Alcoholism
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101107438 (BRAF)
   04012 ErbB signaling pathway
    101107438 (BRAF)
   04015 Rap1 signaling pathway
    101107438 (BRAF)
   04068 FoxO signaling pathway
    101107438 (BRAF)
   04024 cAMP signaling pathway
    101107438 (BRAF)
   04150 mTOR signaling pathway
    101107438 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101107438 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101107438 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101107438 (BRAF)
   04062 Chemokine signaling pathway
    101107438 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101107438 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    101107438 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101107438 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101107438 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101107438 (BRAF)
   04720 Long-term potentiation
    101107438 (BRAF)
   04730 Long-term depression
    101107438 (BRAF)
   04722 Neurotrophin signaling pathway
    101107438 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101107438 (BRAF)
   05205 Proteoglycans in cancer
    101107438 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101107438 (BRAF)
   05212 Pancreatic cancer
    101107438 (BRAF)
   05225 Hepatocellular carcinoma
    101107438 (BRAF)
   05226 Gastric cancer
    101107438 (BRAF)
   05214 Glioma
    101107438 (BRAF)
   05216 Thyroid cancer
    101107438 (BRAF)
   05221 Acute myeloid leukemia
    101107438 (BRAF)
   05220 Chronic myeloid leukemia
    101107438 (BRAF)
   05218 Melanoma
    101107438 (BRAF)
   05211 Renal cell carcinoma
    101107438 (BRAF)
   05219 Bladder cancer
    101107438 (BRAF)
   05215 Prostate cancer
    101107438 (BRAF)
   05213 Endometrial cancer
    101107438 (BRAF)
   05224 Breast cancer
    101107438 (BRAF)
   05223 Non-small cell lung cancer
    101107438 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101107438 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    101107438 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    101107438 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101107438 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101107438 (BRAF)
   05160 Hepatitis C
    101107438 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101107438 (BRAF)
   01522 Endocrine resistance
    101107438 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101107438 (BRAF)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101107438 (BRAF)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101107438 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101107438
NCBI-ProteinID: XP_012032633
Ensembl: ENSOARG00000013581
UniProt: W5PVT2 A0A6P3TLH8
LinkDB
Position
4
AA seq 763 aa
MAALSGGGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEAL
LDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSS
SSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKA
LMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFT
LAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEE
ASLAETTLPCGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSS
SAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLSNVKALQKSPGPQR
ERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKM
LNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHII
ETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRW
SGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQ
IIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKI
HRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcgcggagcagggccaggctctgttcaac
ggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccccgccattccc
gaggaggtgtggaatatcaaacaaatgattaagttgacacaggagcatatagaggcccta
ttggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaa
tacaccagcaagctagacgccctccaacaaagagaacaacagttattggaatccctgggg
aatggaactgatttttctgtttctagctctgcatcaacggacaccgttacatcttcttcc
tcttctagcctttcagtgctgccttcatctctttcagtttttcaaaatcccacagatgtg
tcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaataaa
cagaggacagtggtacctgcacggtgtggagtcacagtccgggacagcctgaagaaggca
ctgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggggag
aagaaaccaattggctgggacactgatatttcctggcttactggagaggaattgcatgta
gaagtgttggagaatgttccacttacaacacacaactttgtacggaaaacttttttcacc
ttagcattttgtgacttctgtagaaagctgcttttccaggggttccgctgtcaaacatgt
ggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgac
caactagatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaggag
gcctccttagcagagactacccttccatgtggctcatccccttctgcacccccctccgat
tctattgggcccccaattctcaccagtccatctccttcaaaatccattccaattccacag
cctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcctca
tcagctccaaatgtgcatataaacacaatagaacctgtcaatattgatgacttgattaga
gaccaagggtttcgtagtgatggaggatcaaccacaggtttatctgccacaccccctgcc
tcattacctggctcactctctaatgtgaaagcattgcagaaatctccaggacctcagcga
gaaaggaagtcctcttcatcctcagaagacaggaatcgaatgaaaacgcttggtagacgg
gactcaagtgacgattgggagattcctgatggacagatcacagtgggacaaagaattgga
tcagggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatg
ttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtaggagta
ctcaggaaaacacgacatgtgaatatcctcctcttcatgggttattcaacaaagccacaa
ctggctattgttacccagtggtgtgagggctccagtttatatcatcatctccacatcatt
gagaccaaattcgagatgatcaaacttatagatattgcacggcagactgcacagggcatg
gattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatttttctt
catgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatctcgatgg
agtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaagta
atcagaatgcaagataaaaacccatatagctttcagtcagatgtgtatgcatttgggatt
gttctgtatgaattgatgaccggacagttaccttattcaaatatcaacaacagggaccag
ataatttttatggtgggacgaggatatctgtctccagatctcagtaaggtacggagtaac
tgtccaaaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagatgaaaga
ccactctttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaatt
caccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggattttagt
ctatatgcttgtgcttctccaaaaacacccattcaggcagggggatatggagaatttgca
gccttcaagtag

DBGET integrated database retrieval system