KEGG   Ovis aries (sheep): 100307042
Entry
100307042         CDS       T03117                                 

Gene name
FEN1
Definition
(RefSeq) flap endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03410  Base excision repair
oas03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100307042 (FEN1)
   03410 Base excision repair
    100307042 (FEN1)
   03450 Non-homologous end-joining
    100307042 (FEN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    100307042 (FEN1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    100307042 (FEN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    100307042 (FEN1)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     100307042 (FEN1)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    100307042 (FEN1)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     100307042 (FEN1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100307042 (FEN1)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100307042 (FEN1)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_5
Other DBs
NCBI-GeneID: 100307042
NCBI-ProteinID: NP_001159668
Ensembl: ENSOARG00000015633
UniProt: C8BKD0
LinkDB
Position
21
AA seq 380 aa
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
TEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSE
PNEEELVRFMCGEKQFSEERIRSGVRRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGAAKKKQRLGPAGKFKRGK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggaattcaaggactggccaaactgatcgctgacgtggcccccagtgccatccgggag
aatgacattaagagctactttggccgcaaggtggccatcgatgcctccatgagcatttat
cagttcctgatagctgttcgccaagggggggatgtgttgcagaatgaggagggggagacc
accagccacctgatgggcatgttctaccgcaccatccgcatgatggagaacggcatcaag
cctgtgtacgtcttcgatggcaagccaccgcagctcaagtccggggagctggccaagcgc
agcgagcggcgggccgaggcggaaaagcagctgcagcaggctcaggccgccggggctgag
acggaggtggaaaagtttacgaagcggctggtgaaggtcaccaaacaacacaacgatgaa
tgcaagcacctcctgagcctcatgggcatcccatacctcgatgcgcccagtgaggcggag
gctagctgtgcggccctggtgaaggccggcaaagtctacgctgcggccacagaggacatg
gattgcctgacgttcggcagcccggtgctcatgcggcacctgactgccagcgaggccaag
aagctgcccatccaggagttccacctgagccggatcctgcaggagctgggcctcaaccag
gagcagtttgtggatctgtgcatcctgctgggcagtgactactgtgagagcatccggggc
atcgggcccaagcgggctgtggacctcatccagaagcacaagagcatcgaggagattgtg
cggcggctggaccccaacaagtaccctgtgccagaaaactggctccacaaggaggcccaa
cagctcttcctggagcctgaggtgttggacccggagtctgtggagctcaagtggagcgag
cccaatgaagaagagctcgtcaggttcatgtgtggggagaagcagttctccgaggagcga
atccgcagtggggtcaggcgactgagcaagagccgccagggcagcacccagggccgcctg
gatgatttctttaaggtgaccggctccctctcttctgccaagcgcaaggagccagagccc
aagggagccgccaagaagaagcaaagactggggccagcagggaagttcaaaagaggaaaa
taa

DBGET integrated database retrieval system