KEGG   Ovis aries (sheep): 100820756
Entry
100820756         CDS       T03117                                 

Gene name
SRD5A2
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
oas  Ovis aries (sheep)
Pathway
oas00140  Steroid hormone biosynthesis
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100820756 (SRD5A2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100820756 (SRD5A2)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100820756 (SRD5A2)
SSDB
Motif
Pfam: Steroid_dh DUF1295
Other DBs
NCBI-GeneID: 100820756
NCBI-ProteinID: XP_027822768
Ensembl: ENSOARG00000010870
UniProt: A0A6P7DVE1
LinkDB
Position
3
AA seq 254 aa
MSVRCQQSPVLAGSATLAALGALVLYLAEPSGYGKYSENLMPVAIRLPARAAWFLQELPS
FAVPAGILAGQPSSLLGPPASVLLGLFCAHYFHRTFVYSLLTRGRPFPVVFLFRGFVFCM
GNGLLQGYYLVYCAEYPAEWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEITYRI
PQGGLFTYVSGANFLGEIIEWIGYALASWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFD
DYPKSRRALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtctgttcgctgccagcagagtccggtgctggcagggagtgccactttggccgccctg
ggggcactggtcctgtacctcgcggagccctctggctacgggaagtactcggagaacctg
atgccggtggctatccgtctgcccgcccgcgccgcctggttcctgcaggagctgccctcc
ttcgcggtgcccgcggggatactcgcagggcagcccagctctcttttgggtccgcctgcg
tctgtgcttctgggcctcttctgcgcgcattacttccacaggacatttgtttattcactg
ctcactagagggaggccgtttccagttgtattccttttcagaggctttgtcttctgcatg
ggaaatggactcctccaaggctactatctggtttactgtgctgaataccctgctgagtgg
tacacagacatacggtttagcctgggtgtcttcttattcattttgggaatgggaatcaac
attcacagtgactatatattgcgccagctcaggaagcctggagaaatcacctataggatt
ccacaaggtggcttgttcacgtacgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggcctcttggtccctcccagcgcttgcatttgcgtttttctca
ctttgtttccttgggctgcgagcttttcatcatcatagattctacctcaagatgtttgat
gactaccccaagtctcgaagagccctcattccattcatcttttaa

DBGET integrated database retrieval system