KEGG   Ovis aries (sheep): 100913162
Entry
100913162         CDS       T03117                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04310  Wnt signaling pathway
oas04390  Hippo signaling pathway
oas04520  Adherens junction
oas04916  Melanogenesis
oas04934  Cushing syndrome
oas05132  Salmonella infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05221  Acute myeloid leukemia
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100913162 (TCF7L1)
   04390 Hippo signaling pathway
    100913162 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100913162 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100913162 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913162 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100913162 (TCF7L1)
   05225 Hepatocellular carcinoma
    100913162 (TCF7L1)
   05226 Gastric cancer
    100913162 (TCF7L1)
   05216 Thyroid cancer
    100913162 (TCF7L1)
   05221 Acute myeloid leukemia
    100913162 (TCF7L1)
   05217 Basal cell carcinoma
    100913162 (TCF7L1)
   05215 Prostate cancer
    100913162 (TCF7L1)
   05213 Endometrial cancer
    100913162 (TCF7L1)
   05224 Breast cancer
    100913162 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100913162 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100913162 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100913162 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100913162 (TCF7L1)
   05165 Human papillomavirus infection
    100913162 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    100913162 (TCF7L1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100913162 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100913162
NCBI-ProteinID: XP_027822527
Ensembl: ENSOARG00000020463
UniProt: A0A6P7DUP1
LinkDB
Position
3
AA seq 587 aa
MPQLGGGGGGGSGGGSGGSGAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPPYPGY
PFLMIPDLSSPYLPNGPLSPGGARTYLQMKWPLLDVPASTTVKDARSPSPAHLSNKVPVV
QHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVG
QIPHPLSWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPT
SGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRA
KVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKK
KKRKREKQLSQTQSQQQQVQEADGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPAT
PSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSSKAAATSSGQMGSQPPL
LSRPLPLGSVPTALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcggcggcggcggcggctcgggaggcggcagcggcggctcgggc
gccggggcagcaggcggaggggacgacctcggggccaacgacgagctgatccccttccag
gacgagggaggcgaggagcaggagccgagcagcgacagcgcgtcggcgcagcgggacctg
gacgaagtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcggactcg
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccacgggactatttt
gccgaagtgagaaggccccaggacggcgcgttctttaaggggcccccctaccctggctac
ccattcctgatgatcccggacctgagcagcccgtacctccccaacggacccctgtctccc
ggaggagcgcgcacgtacctgcagatgaaatggccactcctcgatgtccccgccagcacc
acagtcaaggacgccaggtcaccgtccccagcacacttgtctaataaagttcctgttgtt
cagcacccgcaccacatgcatccgctgacgcccctcatcacctacagcaacgaccacttc
tcccccggctcccctcccacacacctctccccagagatcgatccaaagacaggaatcccc
cggccccctcatccatccgagctgtctccgtattacccactgtctcccggagctgttggg
caaatcccacatcccctcagctggctcgtcccacagcaaggacagcccatgtactccctt
cctcccggtggcttcaggcacccctaccctgccctcgccatgaatgcctcgatgtccagc
ctggtttccagtcggttctcccctcacatggtggctccggcccatcctggtctgcccacc
tcagggatcccccaccccgccattgtctcccccattgtcaagcaggaaccagcgccccct
agcctgagcccagctgtgagcgcgaaatcaccagtcacagtgaagaaagaggaagaaaag
aagccccacgtgaagaagcctcttaatgccttcatgttatatatgaaggagatgagggcc
aaggtggtggctgagtgcaccctgaaggagagtgcagccatcaaccagatcctgggaagg
aagtggcacaacctgtcccgagaagaacaggccaagtactacgaattggcccgaaaggag
cggcagcttcactcacagctctacccgacctggtcagcccgggacaactacggtaagaaa
aagaagaggaagcgagaaaagcagctgtcccagacacagtcccagcagcagcaagtccag
gaggcagatggtgctctggcctccaaaagcaagaagccatgtgtccagtacctgcccccc
gagaagccctgtgacagcccagcttcctcccacggcagcatgctggactccccagctacc
ccctccgcggccttggcctccccggccgccccagccgccacccactcggagcaagcccag
cccctctccctcaccaccaagccagagacccgggcccagctggctctccactcagccgcc
ttcctgtcatcaaaggctgccgccacctcttctggccagatgggcagccagcccccgctc
ctgtcccggcccctccctttggggtctgtgcccacagctctgctgacgtcccccccatcc
ttccccgccacgctccacgcccaccaggccctccccgtgctccaggcccagcctctgtcc
ttggtcaccaagtctgcccactaa

KEGG   Ovis aries (sheep): 101101980
Entry
101101980         CDS       T03117                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
oas  Ovis aries (sheep)
Pathway
oas04310  Wnt signaling pathway
oas04390  Hippo signaling pathway
oas04520  Adherens junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04916  Melanogenesis
oas04934  Cushing syndrome
oas05132  Salmonella infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05221  Acute myeloid leukemia
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101101980 (TCF7)
   04390 Hippo signaling pathway
    101101980 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101101980 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    101101980 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101101980 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101980 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101101980 (TCF7)
   05225 Hepatocellular carcinoma
    101101980 (TCF7)
   05226 Gastric cancer
    101101980 (TCF7)
   05216 Thyroid cancer
    101101980 (TCF7)
   05221 Acute myeloid leukemia
    101101980 (TCF7)
   05217 Basal cell carcinoma
    101101980 (TCF7)
   05215 Prostate cancer
    101101980 (TCF7)
   05213 Endometrial cancer
    101101980 (TCF7)
   05224 Breast cancer
    101101980 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101101980 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101101980 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101101980 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101101980 (TCF7)
   05165 Human papillomavirus infection
    101101980 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101101980 (TCF7)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101101980 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101101980
NCBI-ProteinID: XP_012033879
UniProt: A0A6P3TH02
LinkDB
Position
5
AA seq 418 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAASDAGVPGAGAGARGEAEVGAEALGRAHTSQRLFPDKLPESLEDGLKAPECTSGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLNKASQPSHGVPQLSPLYDHFSSPHPTPAPADI
SQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAP
GAPYPRFTHPPLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRSLKAQADSKAEKEAKK
PTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKER
QLHMQLYPGWSARDNYGKKKRRSREKHQESNSGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggtggcgcgggcggcggcgacgacctcggcgcgccg
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgcgggccccgagcgcgacctggctgagctcaagtcgtcgctcgtcaatgagtccgag
ggcgcggccagcgacgcgggggtcccgggggcgggcgccggtgcccgcggcgaggccgag
gtcggggcggaggctctcgggcgggcacacacttcgcagagacttttccccgacaaactt
ccagagtctctggaagacggcctgaaggccccggagtgcaccagcggcatgtacaaagac
accgtctactccgccttcaatctgctcatgcactacccgcccccctcgggagcagggcag
cacccccagccgcagcccccgctgaacaaggccagtcagccttcccatggtgtcccccaa
ctttctcctctctatgaccatttcagcagcccacaccccacacctgcaccagctgacatc
agccagaagcaaggagttcacaggcctctgcagacccctgacctctctggcttctactct
ctgacctcaggcagcatgggacagctcccccacactgtgagctggcccagccctcctctc
taccccctgtccccttcctgcggatatagacagcacttccctgcccccaccgcagcccct
ggcgccccctaccccaggttcacccatccacccctgatgctaggttctggtgtccctggt
caccccgcagccatcccccacccagccatcgtaccctcttcagggaagcaggagctgcag
ccctatgaccgcagcctgaaagctcaagcagactctaaggcagagaaggaagccaagaag
ccgaccatcaagaagcccctcaacgccttcatgctatacatgaaggagatgagagccaaa
gtcattgccgaatgcacgctcaaggagagtgctgccatcaaccagatcctgggccgtcgg
tggcacgcactgtcccgggaagagcaggccaagtattacgagctggcccgcaaggagagg
cagctgcacatgcagctatacccaggctggtcggcgcgggacaactacgggaagaagaag
agacggtcgagggaaaagcaccaagaatccaactcaggaggaaaaagaaatgcattcggt
acttacccggagaaggccgctgccccagccccgttccttccgatgacagtgctctag

KEGG   Ovis aries (sheep): 101118068
Entry
101118068         CDS       T03117                                 

Gene name
TCF7L2
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7-like 2
  KO
K04491  transcription factor 7-like 2
Organism
oas  Ovis aries (sheep)
Pathway
oas04310  Wnt signaling pathway
oas04390  Hippo signaling pathway
oas04520  Adherens junction
oas04916  Melanogenesis
oas04934  Cushing syndrome
oas05132  Salmonella infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05221  Acute myeloid leukemia
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101118068 (TCF7L2)
   04390 Hippo signaling pathway
    101118068 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101118068 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101118068 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101118068 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101118068 (TCF7L2)
   05225 Hepatocellular carcinoma
    101118068 (TCF7L2)
   05226 Gastric cancer
    101118068 (TCF7L2)
   05216 Thyroid cancer
    101118068 (TCF7L2)
   05221 Acute myeloid leukemia
    101118068 (TCF7L2)
   05217 Basal cell carcinoma
    101118068 (TCF7L2)
   05215 Prostate cancer
    101118068 (TCF7L2)
   05213 Endometrial cancer
    101118068 (TCF7L2)
   05224 Breast cancer
    101118068 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101118068 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101118068 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101118068 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101118068 (TCF7L2)
   05165 Human papillomavirus infection
    101118068 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101118068 (TCF7L2)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    101118068 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 101118068
NCBI-ProteinID: XP_027816393
UniProt: A0A6P7DCG0
LinkDB
Position
22
AA seq 621 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGTLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSAKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPC
RRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPSSPNLLGSPPQDAKSQTEQTQPLSLSLKP
DPLAHLSMMPPPPALLLAEAAHGKAPALCANGALDLPPAALQPPASPPASLAQPSTSSLH
SHGALAGTQPQPLSLVTKSLE
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcggagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaactctccattttcagtccgggagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcagatgaaatggccactgcttgac
gtccaggcggggaccctccagagcagacaagccctcaaggatgctcgctctccgtcgcca
gcccacatcgtttcgaacaaagtgccggttgtgcagcacccgcatcatgtccaccctctc
acgcctcttatcacatacagcaatgaacacttcacgccgggaaacccacctccacactta
ccagctgacgtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatct
ccgtactacccgctgtcacctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcagccagtgtaccccatcacgacaggaggattccgtcacccctac
cccacagctctgactgtcaacgcttccatgtccaggttccctccccacatggtcccacca
catcacactctgcacacgactggcattccccacccggccatagtcacgccgacagtcaaa
caggagtcctcgcagagtgacgtcggctcactccacagcgcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaatgcattcatgttgtat
atgaaggaaatgagagcaaaggttgtagccgagtgcacgttgaaagaaagtgcagccatc
aaccagatcctgggccggaggtggcacgcgctgtccagagaagagcaagcaaagtactac
gaattggcccgaaaggagcgacagcttcacatgcagctgtaccccggctggtccgcacgg
gataactatgggaaaaagaagaagaggaaaagggacaagcagcctggggagaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgc
aggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccc
tcttcagatggaagcttactagactcgcctccttcctcccccaacctgctaggctccccc
ccccaggacgccaagtcacagactgagcagacccagcctctgtcgctgtccctgaagccc
gaccccctggcccacctgtccatgatgcctccgccgcccgccctcctgcttgccgaggcc
gcccacggcaaggcccccgccctctgtgccaacggggccctggacctgccccccgccgct
ctgcagccgcctgcctccccccccgcatctctggcacagccgtcgacatcttccttacat
tcccacggcgctctggccgggacccagccccagccgctgtccctcgtcaccaagtcttta
gaatag

KEGG   Ovis aries (sheep): 780521
Entry
780521            CDS       T03117                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X2
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04310  Wnt signaling pathway
oas04390  Hippo signaling pathway
oas04520  Adherens junction
oas04916  Melanogenesis
oas04934  Cushing syndrome
oas05132  Salmonella infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05221  Acute myeloid leukemia
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    780521 (LEF1)
   04390 Hippo signaling pathway
    780521 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    780521 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    780521 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780521 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    780521 (LEF1)
   05225 Hepatocellular carcinoma
    780521 (LEF1)
   05226 Gastric cancer
    780521 (LEF1)
   05216 Thyroid cancer
    780521 (LEF1)
   05221 Acute myeloid leukemia
    780521 (LEF1)
   05217 Basal cell carcinoma
    780521 (LEF1)
   05215 Prostate cancer
    780521 (LEF1)
   05213 Endometrial cancer
    780521 (LEF1)
   05224 Breast cancer
    780521 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    780521 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    780521 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    780521 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    780521 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    780521 (LEF1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    780521 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 780521
NCBI-ProteinID: XP_004009682
Ensembl: ENSOARG00000008064
UniProt: W5PDZ0 A0A6P3EDN1
LinkDB
Position
6
AA seq 399 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDDGKHPDGGLYSKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggtgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggagaagatcttcgccgag
atcagtcaccctgaagaggaaggtgacttagccgacatcaagtcttccttggttaacgaa
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacctctcag
gagtcgtaccatgacaaggccagagaacatcctgatgatggaaagcatccagatggaggt
ctctacagtaagggaccctcttattcgagttattctggatacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttcgccacccatcccaagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccctctcatcacgtac
agcgacgagcacttttctccaggatcacacccgtcacatatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcccgagatccctacgttttatcccctgtct
ccaggtggtgttggacagataaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggaggcttcaggcagccctacccatcctcactgtcagtcgacacttccatgtcc
aggttttctcatcatatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagccatcgtaacgcctcaggtcaaacaggaacacccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaaa
aagcctctgaatgcttttatgttatacatgaaagaaatgagagcgaatgtcgtagctgag
tgtactctaaaggaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctc
tctcgtgaagagcaggctaaatattatgaattagcgcggaaggaaagacagctacatatg
cagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaagctacaggagtccacatcaggtacaggtccaagaatgacagctgcctacatctga

DBGET integrated database retrieval system