KEGG   Ovis aries (sheep): 101101902Help
Entry
101101902         CDS       T03117                                 

Gene name
P2RX1
Definition
(RefSeq) P2X purinoceptor 1
  KO
K05215  P2X purinoceptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101101902 (P2RX1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101101902 (P2RX1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101101902 (P2RX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101101902 (P2RX1)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101101902 (P2RX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor
Motif
Other DBs
NCBI-GeneID: 101101902
NCBI-ProteinID: XP_004012622
Ensembl: ENSOARG00000017892
UniProt: W5Q906
LinkDB All DBs
Position
11
AA seq 399 aa AA seqDB search
MAQRIQDELAAFFFEYDTPRMVLVRNKKVGVVFRLIQLVVLVYVVGWVFVYEKGYQTSSS
LISSVSIKLKGLAVTQLPSLGPQVWDVADYVFPAQGDSSFVVMTNFIATPRQAQGHCAEN
PEGGTCTNNSGCTPGKAERKAQGIRTGKCVAFNDTVQTCEIFGWCPVEVDDNIPCPALLR
EAENFTLFIKNSISFPRFKVTRRNLVEEVDARYMKTCLFHKTLHPLCPVFKLGYVVQESG
QNFSTLAEKGGVVGITIDWHCDLDWHVRHCKPVYEFHGLYEEKKLSQGFNFRFARHFVEN
GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGSGAGERDPAATGSTLVLQENMKTS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcggatccaggatgagctggctgccttcttcttcgagtacgacaccccccgg
atggtgcttgtgcgcaacaagaaggtgggcgtcgtcttccgcctgatccagctcgtggtc
ctggtctacgtcgttgggtgggtgtttgtctacgagaagggctaccagacctcgagcagc
ctcatcagcagtgtgtctattaaactcaaaggtctggctgtgacacagctcccaagcctg
ggcccccaggtctgggatgtggctgactacgtcttcccagcacagggggacagctccttc
gtggtcatgaccaattttatcgccaccccccggcaggctcaaggtcactgtgcagagaat
ccggaagggggcacgtgcacaaataatagcggctgcaccccgggaaaggcagaaagaaag
gcccaaggcatccgcacaggcaagtgtgtggccttcaacgacaccgtgcagacctgcgag
atctttggctggtgccccgtggaggtggatgacaacatcccatgccctgcccttctccga
gaggccgagaacttcactctcttcatcaagaacagcatcagctttccacgcttcaaggtc
accaggcgcaacctggtggaggaggtggatgcccgctacatgaagacctgcctctttcac
aagaccttgcaccctctgtgtccagtcttcaagctcggctatgtggtacaggagtcaggc
cagaatttcagcaccttggccgagaagggtggggtggtgggcatcaccatcgactggcac
tgtgacctggactggcacgtgcggcactgcaaacccgtctacgagttccatgggctgtat
gaggagaaaaaactgtctcaaggcttcaacttcaggtttgccaggcactttgtggagaat
gggaccaactaccggcacctcttcaaggtgtttgggattcgctttgacatcctggtggac
ggcaaggctgggaagtttgacatcattcccacaatgaccaccatcggctctgggattggc
atcttcggggtggccacggttctctgtgacctccttctgctccacatcctgcccaagagg
cactactacaagcagaagaagttcaagtacgcggaggacatgggctcaggggcgggagag
cgtgaccccgcggccaccggctccaccctggttctgcaggagaacatgaagacatcctga

KEGG   Ovis aries (sheep): 101103842Help
Entry
101103842         CDS       T03117                                 

Gene name
P2RX7
Definition
(RefSeq) P2X purinoceptor 7
  KO
K05220  P2X purinoceptor 7
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101103842 (P2RX7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101103842 (P2RX7)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101103842 (P2RX7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101103842 (P2RX7)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101103842 (P2RX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor Keratin_matx
Motif
Other DBs
NCBI-GeneID: 101103842
NCBI-ProteinID: XP_027812296
Ensembl: ENSOARG00000015479
LinkDB All DBs
Position
17
AA seq 595 aa AA seqDB search
MTACCSWNDVFQYETDKIIWIQSKTYGTIKWFFHVVLFSYIGFALVSDKRYQRKEPVISS
VHSKIKGIAEVKKEIMENGQKKVVRSVFDMADYTFPLQGNSFFMMTNFLKTEGQEQGLCP
EYPTPRTLCSSDRGCKKGWLGPLSKGIQTGRCVDYKEKQKTCEVFAWCPVEAAEKAPAPA
LLVSAENFTVLIKNNIDFPGHNYTTRNILPDLNSTCTFHKTRDPQCPIFRLGDIFQETGD
NFSEVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTAKESLYPGYNFRYAKYYK
ENNTEKRTLIKAYGIRFDILVFGTGGKFDIIQLIVYIGSTLSYFGLATVFIDMLINTYSS
KYCKSHIYPWCKCCQPCAVNEYYYKKKYESIVEPTRTLKYVSFVDEPYIRMVNERLLGRS
LQDVKGEKVLRPQLDFADLSWLPLSLHDLPPIPGQPEEIQLLSEEVHLKSRDCPDWCQCG
NCLPSQLPENQRCLEELCCRKKLGACITTSELFRDLVLSRRTLQFLVQYQEPLLVLDADS
ANSRLRHCAYRSYTTWRFGSQDLADFAILPSCCRWRIRREFPKSEGQYSGFKSPY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacagcctgctgcagctggaatgatgttttccagtatgagacagacaaaatcatctgg
atccaaagcaagacttatggcaccattaaatggttcttccacgtggtgctcttttcttac
attggctttgctttggtgagtgacaagcggtaccaacggaaagagcctgtcatcagttct
gtgcacagcaagataaaagggatagcagaggtgaaaaaggagattatggagaatgggcag
aagaaggttgtgcggagtgtctttgatatggcggattacaccttccccttacaggggaac
tccttttttatgatgacaaactttctcaagacagaaggccaagagcaagggttgtgtcct
gagtaccccacccccaggacgctctgttcctctgatcggggctgtaaaaagggatggctg
ggcccactgagcaaaggaatccagactggcaggtgtgtagattataaagagaagcagaag
acctgtgaagtcttcgcctggtgtcctgtcgaggcagcggaaaaggctccggcgcctgcg
ctcttggtcagtgctgaaaactttactgtactcatcaagaataatatcgacttccctggc
cacaattacaccacgagaaacatcttgccggatttaaacagcacttgcacctttcacaag
actcgggatccacagtgtcccattttccgactaggagatatcttccaagaaacaggagat
aatttttcagaagtggcaattcagggaggaatcatgggtattgaaatctactgggactgc
aacctggacagatggttccatcactgccgtccaaaatacagtttccgtcgccttgacgac
aagaccgccaaggagtccttgtaccctggctacaacttcagatatgccaagtactataag
gaaaataacactgaaaagcggaccctaataaaagcttacgggatccgatttgacatcctg
gttttcggcactggggggaaattcgacatcatccagctgatcgtgtacattggttcaacc
ctctcctactttggtttggccactgtgttcattgacatgctcatcaacacttactcaagt
aaatactgtaaatcgcacatttatccctggtgcaagtgctgtcaaccctgcgcagtcaat
gaatactactacaagaagaagtatgaatccattgtggagccaacacggacattaaaatat
gtgtcctttgtggatgaaccctatattaggatggtaaatgaacgactgcttgggagaagt
ctgcaagatgtcaaaggtgaaaaagtcctgagaccccagctggactttgcagacttgtcc
tggctgcctctgtctcttcacgacctaccccccattcccggacaaccagaggaaatccag
ctgctcagtgaagaggtgcaccttaaatccagggactgcccggattggtgccagtgcgga
aactgccttccatcccaactccctgagaaccaaagatgcctggaggagctgtgctgccgg
aagaagctgggtgcctgtattaccacctcagagctattcagggaccttgtgctatccagg
cggaccctgcagttcctagtgcagtaccaggagcccttgctggtgctggatgcagattct
gccaacagccggctgcggcactgtgcctacaggagctacaccacctggcgctttggctcc
caggacctggctgacttcgccatcctgcccagttgctgccgctggaggatccggagagag
ttccccaagagtgaaggccaatacagtggcttcaagagtccttactga

KEGG   Ovis aries (sheep): 101104013Help
Entry
101104013         CDS       T03117                                 

Gene name
P2RX4
Definition
(RefSeq) P2X purinoceptor 4 isoform X1
  KO
K05218  P2X purinoceptor 4
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101104013 (P2RX4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101104013 (P2RX4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101104013 (P2RX4)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101104013 (P2RX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor WAP
Motif
Other DBs
NCBI-GeneID: 101104013
NCBI-ProteinID: XP_004017629
Ensembl: ENSOARG00000015214
LinkDB All DBs
Position
17
AA seq 388 aa AA seqDB search
MAGCCAVLGAFLFEYDTPRIVLIRSRKVGLMNRTVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTVKAKGVTMTNTSKLGFRIWDVADYVIPAQEENSVFIMTNMVITMNQTQGFCPEIP
GKTTVCETDANCTAGSAGTHSSGVATGRCVSFNGTLKTCEVAAWCPVEDDTEVPKPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTAYLKTCIYDAKTDPFCPIFRLGKIVEYAG
HSFQDIATEGGIMGIQIKWNCNLDRAASFCLPRYSFRRLDTRDTAHNVSPGYNFRFAKYY
SDPNGAEHRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGVATVLCDVIVLYC
MKKRYYYREKKYKYVEDYEQGLGNQMDQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctgctgcgcggtgctgggggccttcctgttcgagtacgacacgccgcgcatc
gtgctcatccgcagccgtaaagtggggctcatgaaccgcacggtgcagctgctcatcctg
gcctacgtcatcgggtgggtgtttgtgtgggaaaagggttaccaggaaacagactctgtg
gtcagctcagttactgtgaaagccaagggcgtcaccatgaccaacacttctaaacttgga
ttccggatctgggatgtagctgattatgtgattccagctcaggaggaaaactctgtcttc
atcatgaccaacatggtcatcaccatgaaccagacacaaggattctgtcctgagatcccg
ggtaagaccactgtgtgtgaaactgatgccaactgcactgccggctctgcaggcacccac
agcagcggagtcgcgacagggaggtgcgtgtcattcaatgggaccttgaagacatgcgag
gtggcagcctggtgcccggtggaggacgacacagaagtgccaaagcctgcttttttaaag
gctgcggaaaacttcactcttttggttaagaacaacatctggtatcccaaatttaacttc
agcaagaggaatatccttcccaacatcaccaccgcctacctcaaaacatgcatttatgat
gcgaaaacagatcccttctgccccatattccgacttggaaaaattgtggagtacgcaggg
cacagcttccaggacatagccactgagggaggcatcatgggcatccagatcaagtggaac
tgcaacctggacagggccgcctccttctgcctgcccaggtattccttccgccgcctggac
acccgggacacagcccacaacgtatccccaggctacaatttcaggtttgccaagtactac
agcgacccgaatggtgctgagcaccgcacgctcatcaaagcctatggcatccgctttgac
atcattgtgtttggaaaggctgggaaatttgacatcatccccaccatgatcaacattggt
tccggcttggcgctcttaggggtggcaacagtgctgtgtgacgtcatagtcctctactgc
atgaagaagagatattactatcgcgagaaaaaatataaatacgtggaagattacgagcag
ggtcttggtaatcagatggaccaatga

KEGG   Ovis aries (sheep): 101104779Help
Entry
101104779         CDS       T03117                                 

Gene name
P2RX3
Definition
(RefSeq) P2X purinoceptor 3
  KO
K05217  P2X purinoceptor 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101104779 (P2RX3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101104779 (P2RX3)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    101104779 (P2RX3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101104779 (P2RX3)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101104779 (P2RX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor UPF0014 WAP
Motif
Other DBs
NCBI-GeneID: 101104779
NCBI-ProteinID: XP_014956651
LinkDB All DBs
Position
15
AA seq 397 aa AA seqDB search
MNCISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGFGRYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKFRCVSDS
QCGPERFPGGGILTGRCVNYSSALRTCEIQGWCPAEVDTVETPVMMEAENFTIFIKNSIR
FPLFNFEKGNLLPDLTAADVKTCRFHPDRAPFCPILRVGDVVKFAGQDFAKLAQTGGVLG
IKIGWVCDLDKAWDQCIPRYSFTRLDGVSEKSSVSPGYNFRFAKYYKMDNGSEYRTLLKA
FGIRFDVLVYGDAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKARKFEE
VSETTLRVPASAHPRDTGDQTTEEKQSTDSGAYSIGH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactgcatctcagatttcttcacctacgagaccaccaagtcggtggtcgtgaagagc
tggaccattgggatcatcaacagagcggttcagcttctcatcatctcctacttcgtgggg
tgggttttcctgcacgagaaggcgtaccaggtgcgggacacagccatcgagtcctcggtg
gtgaccaaggtcaagggcttcggacgctatgccaaccgagtcatggacgtgtctgattac
gtgaccccaccccagggcacctctgtctttgtcatcatcaccaagatgatcgtcacagaa
aaccagatgcaaggcttctgcccagagagcgaggagaagttccgctgtgtgtcggacagc
cagtgcgggcctgagcgcttcccaggaggagggatcctcaccggccgctgcgtcaactac
agctctgcgctgcggacctgcgagatccagggctggtgcccagcggaggtggacacggtg
gagacgcctgtcatgatggaagccgagaatttcactattttcatcaagaacagcatccgt
ttccccctcttcaacttcgagaaggggaacctcctccccgacctaacagctgccgacgtg
aagacctgccgcttccaccccgacagagcccccttctgccccattctgcgggtgggcgac
gtggtcaagtttgcagggcaggattttgccaagctggcccaaacgggcggagtcctgggc
attaagatcggctgggtgtgcgacctggacaaggcctgggaccagtgcatccccagatac
tccttcacccggctggacggcgtttccgagaagagcagtgtctccccggggtacaatttc
aggttcgccaagtactacaagatggacaacggcagtgagtaccgcaccctgctgaaggct
ttcggcatccgcttcgacgtgctggtgtacggggacgctggcaagttcaacatcatcccc
accatcatcagctccgtggcggccttcacctcggtgggagtgggcaccgtcctctgcgac
atcatcctgctgaacttcctcaagggggccgaccagtacaaggctaggaagttcgaggag
gtgagtgagacgacgctgagggtcccagcctctgcccacccccgggacaccggcgaccag
accacggaggagaagcagtccacggactcgggcgcctactctatcggccactaa

KEGG   Ovis aries (sheep): 101110429Help
Entry
101110429         CDS       T03117                                 

Gene name
P2RX5
Definition
(RefSeq) P2X purinoceptor 5 isoform X1
  KO
K05219  P2X purinoceptor 5
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101110429 (P2RX5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101110429 (P2RX5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101110429 (P2RX5)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101110429 (P2RX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor
Motif
Other DBs
NCBI-GeneID: 101110429
NCBI-ProteinID: XP_004013313
Ensembl: ENSOARG00000017481
UniProt: W5Q7S4
LinkDB All DBs
Position
11
AA seq 451 aa AA seqDB search
MGQAGCKGLYQSLFDYKTEKYVIAKNKKVGLLYRLLQVSILTYLVVWVFLVKKCYQDTDT
SLQSSIITKVKGVTFTNTSELGERLWDVADYVIPPQGENVFFVITNLVVTPNQRQETCAE
STSVPDALCYEDSDCPPGEPVVAGNGVRTGRCLREGSAQKGTCEIFAWCPVETRSRPTKP
LLGEAKDFTVYIKNFIRFPKFNFSKTNVLDTTDRTFLKSCKFSPENPYCPIFRLGSVVSW
TGSNFQEIAVQGGVIGIQIEWDCDLDKAPSECYPRYYFNRLDNRFSGNSISSGYNFRFAK
YYRDAAGVEFRTLFKAYGIRFDVMVNGKAGKFNIIPTIINVGSGVALMGVGSFFCDLVLI
YFIKKSHFYRDKKYEEVRDLEVLAQMAESSQQSVALDAAGLAEQPEVQDEGSAQKENGCV
CGQLPQPARSGHQGNGKVSMEQLQSLQTAEA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggcgggctgcaaggggctctaccagtcgctcttcgactacaagaccgagaag
tacgtcatcgccaagaacaagaaggtgggcctgctctaccggctgctgcaggtctccatc
ctgacctacctggtggtttgggtgttcctggtgaagaagtgttaccaagacacggacacg
tccctgcagagcagcatcatcaccaaagtcaagggtgtgactttcaccaacacctcggag
cttggggagcggctctgggatgttgctgactacgtcatcccaccccagggagagaacgtc
ttcttcgtaatcaccaacctggtcgtgacccccaaccagcggcaggaaacctgtgctgag
agtacaagtgttcccgatgccctgtgctatgaggacagcgactgccctcctggggagcct
gttgtggctggaaatggagtgaggaccggccgctgcctgcgggaggggagcgcacagaag
ggcacctgtgagatcttcgcctggtgcccggtggagacaagatccaggccaacgaagcca
ctcctgggcgaagccaaagacttcactgtttacataaagaacttcattcgcttccccaag
ttcaacttctccaagaccaatgtgctggacaccacagacagaactttcctgaagtcctgt
aagtttagccccgagaacccctactgccccatcttccgactgggctctgtggtcagctgg
acggggagcaacttccaggagatagcggtgcagggcggtgtgataggaattcagatcgaa
tgggactgtgatcttgataaagcgccttctgaatgttaccctcgctattactttaaccgt
ctggacaacagattttcaggaaactctatctcttccgggtacaacttcaggtttgccaag
tactaccgagatgcagctggggtggagttccgcacactgtttaaagcctacgggatccgc
ttcgatgtgatggtgaatggcaaggctggcaagttcaacatcatccccacgatcatcaac
gtgggctcaggggtggcactcatgggagtggggtctttcttctgtgacctggtactcatc
tacttcatcaaaaagagccacttttatcgagacaagaaatacgaggaagtgagggaccta
gaggtcctcgcccaaatggcagaatcctcacagcagagcgtggccctggacgcagcgggg
ctggcggagcagccagaggtgcaggatgaaggcagcgcccagaaggagaacggctgtgtg
tgtgggcagctcccccagcctgccaggtccggccaccaggggaacgggaaggtgagcatg
gagcagctgcagagcctgcagaccgcggaggcgtag

KEGG   Ovis aries (sheep): 101116428Help
Entry
101116428         CDS       T03117                                 

Gene name
P2RX2
Definition
(RefSeq) P2X purinoceptor 2 isoform X1
  KO
K05216  P2X purinoceptor 2
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101116428 (P2RX2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101116428 (P2RX2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    101116428 (P2RX2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101116428 (P2RX2)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101116428 (P2RX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor DUF2645
Motif
Other DBs
NCBI-GeneID: 101116428
NCBI-ProteinID: XP_027836033
Ensembl: ENSOARG00000011040
LinkDB All DBs
Position
17
AA seq 479 aa AA seqDB search
MAAAEPKPPTGAAAARRLARSCWSAFWDYETPKVIVVKNRRLGIVYRAVQLLILLYFVWY
VFIVQKSYQDSETGPESSVITKVKGITLSEHKVWDVEEYVKPPEGGSVFSIITRIEVTPF
QTLGTCAESMRVSNATCDSDEDCVAGQLDMLGNGLRTGRCVPYYHGSSKTCEVSAWCPVE
DGASVSQFLGTMAPNFTILIKNSIHYPKFQFSKGNIENRKGGYLKHCTFHEVSDLYCPIF
KLGYIVEQAGENFTELAHTGGVIGVIINWDCDLDLSASECNPKYSFRRLDPKHIPASSGY
NFRFAKYYKINGSITRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLC
DWILLTFMNKNKVYSHKKFDKVCTPSHSSGSWPVTLALVLGQAPPPPYPCSPDPGQAGQL
QGEGQSQAWAAPPPWPCPTSAPSEQMVDAPERGAGPGLCASEPSQQDCVLTDARGLAQL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccgagcccaagcccccaacgggggcggccgcggcccgacgcctggcccgg
agctgctggtccgcgttctgggactacgagacgcccaaggtgatcgtggtgaagaaccgg
cgtttgggcatcgtgtaccgcgcggtgcagctgctcatcctgctctacttcgtgtggtac
gtgttcatcgtgcagaagagctaccaggacagcgaaacgggccccgagagctccgttatc
accaaggtcaagggcatcaccttgtccgaacacaaagtgtgggacgtggaggagtacgtg
aaaccaccggagggaggcagcgtgttcagcatcatcaccaggattgaggtcacccccttc
cagaccctcggaacatgcgccgagagtatgagggtcagcaacgccacctgcgactcggac
gaggactgtgtggctgggcagctggacatgctgggaaacggcctgcggactgggcgctgc
gtaccttattaccacgggtcctccaagacctgcgaggtgtccgcctggtgcccggtggaa
gacggggcctcagtcagccaatttctcggtacgatggcccccaatttcaccatcctcatc
aagaacagcatccactaccccaaattccagttctccaagggcaacattgagaaccgaaag
ggtggctacctgaagcactgcacattccatgaggtctctgacctctactgccccattttc
aagctggggtacatcgtggagcaggcaggggagaacttcacagagctggcacacacgggt
ggtgtcatcggggtcattatcaactgggactgtgacctggacctttcagcgtcagagtgc
aaccccaaatactccttccggaggctggaccccaagcacatcccagcctcatctggctac
aacttcaggtttgccaagtattacaaaataaatggcagcattacccgcacactcatcaaa
gcctatgggatccgcattgatgtcatcgtgcacgggcaggcggggaagttcagcctgatt
cccaccatcattaacctggccacagcgctgacctccattggggtgggctccttcctgtgc
gactggatcttgctaacattcatgaacaaaaacaaggtctacagccataagaaatttgac
aaggtgtgtactccaagtcactcctcaggcagctggcctgtgaccctggcccttgtcttg
ggccaggcccctcccccaccctatccctgctctccagacccaggccaggctggccaactg
cagggtgaggggcagagccaggcctgggctgccccacccccatggccttgccccacctct
gccccatctgagcagatggtggatgctcccgagcggggtgcgggaccagggctttgcgcc
tccgagccttcccaacaggactgcgtgctcacagacgcccgaggtttggcccagctctga

KEGG   Ovis aries (sheep): 101118819Help
Entry
101118819         CDS       T03117                                 

Gene name
P2RX6
Definition
(RefSeq) P2X purinoceptor 6 isoform X1
  KO
K05221  P2X purinoceptor 6
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101118819 (P2RX6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101118819 (P2RX6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101118819 (P2RX6)
Ion channels [BR:oas04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   101118819 (P2RX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor WAP
Motif
Other DBs
NCBI-GeneID: 101118819
NCBI-ProteinID: XP_014957240
Ensembl: ENSOARG00000016766
LinkDB All DBs
Position
17
AA seq 393 aa AA seqDB search
MGSPGARVGWGLLDYKTEKYVMTRNWRVGALQRLLQLGVVVYVVGWALLTKKGYQEQDLD
PQISVITKLKGVSVTRIEELGNRLWDVADFVKPPQGENVFFLVTNFLVTPGQVQGRCPEH
PSIPLANCWADQDCPEGETGTHSHGIKTGQCVVFNATHRTCEIRGWCPVESGAAPVKPLL
LQAENFTLFIKNTVTFSKFNFSRSNALDTQDPTYFKLCRYDPRSSPACPVFRIGDLVAAA
GGVFEDLALLGGAVGVHVRWDCDLDSRGADCQPQYSFQLQERSYNFRTATHWWESPGVEA
RSLLKLYGIRFDILVTGRAGKFGLIPTLISLGTGAAWLGVITFLCDLLLLYVDGEAHFYW
RTKYEEAKAPKRTAQPEQTEPAPTPPRPAVQGP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgggctccccaggcgccagggtgggctgggggcttctggattacaaaacggagaagtat
gtgatgacccggaactggcgggtgggcgccctgcagaggctgctgcagctgggggtcgtg
gtctacgtggtggggtgggccctcctcaccaaaaaaggctaccaggagcaggacctggac
ccccagatctctgtcatcaccaagctcaagggggtctccgtgacccggatcgaggagctg
gggaaccggctgtgggacgtggctgacttcgtgaagccaccacagggcgagaacgtgttc
ttcttggtgaccaacttcctcgtgacgccaggacaagtccagggcaggtgcccagagcac
ccgtccatcccgctggccaactgctgggccgaccaggactgtcccgagggggagacgggg
acgcacagtcatggcataaagacgggccagtgcgtggtgttcaatgcgacccacaggacc
tgcgaaatccggggctggtgtccagtggagagcggtgctgcgcccgtgaagcccctgctt
ctccaggctgagaacttcaccctgttcatcaaaaacaccgtcaccttcagcaagtttaac
ttctccaggtccaacgccctggacacccaggaccccacctacttcaagctctgccgttat
gacccccgctccagccccgcctgccccgtgttccgcattggggacctcgtggctgcagcc
ggaggggtctttgaggatctggcgctgctgggcggggccgtgggtgtccacgtccgctgg
gactgcgacctggacagcaggggcgcggactgccagccccagtactcctttcagctgcag
gagcggagctacaacttcaggacagccacacattggtgggagagcccgggcgtggaggcc
cgcagcctgctcaagctctatgggatccgtttcgacatcctggtcacagggcgggcaggg
aaattcgggctcatccccacgcttatctctctgggcacaggagcagcctggctgggtgtg
atcaccttcctctgtgacctgctgctgctgtacgtggacggagaagcgcacttctactgg
aggaccaagtatgaggaggcaaaggctccaaagaggaccgcccagcccgagcagacagag
ccggcacccacacccccgcgcccggccgtccaggggccttag

DBGET integrated database retrieval system