KEGG   Ovis aries (sheep): 101102191
Entry
101102191         CDS       T03117                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
oas  Ovis aries (sheep)
Pathway
oas01523  Antifolate resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04064  NF-kappa B signaling pathway
oas04066  HIF-1 signaling pathway
oas04071  Sphingolipid signaling pathway
oas04137  Mitophagy - animal
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04218  Cellular senescence
oas04380  Osteoclast differentiation
oas04620  Toll-like receptor signaling pathway
oas04621  NOD-like receptor signaling pathway
oas04622  RIG-I-like receptor signaling pathway
oas04623  Cytosolic DNA-sensing pathway
oas04625  C-type lectin receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04659  Th17 cell differentiation
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04668  TNF signaling pathway
oas04722  Neurotrophin signaling pathway
oas04917  Prolactin signaling pathway
oas04920  Adipocytokine signaling pathway
oas04926  Relaxin signaling pathway
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05030  Cocaine addiction
oas05132  Salmonella infection
oas05133  Pertussis
oas05134  Legionellosis
oas05135  Yersinia infection
oas05140  Leishmaniasis
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05146  Amoebiasis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05203  Viral carcinogenesis
oas05212  Pancreatic cancer
oas05215  Prostate cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05321  Inflammatory bowel disease
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101102191 (RELA)
   04014 Ras signaling pathway
    101102191 (RELA)
   04064 NF-kappa B signaling pathway
    101102191 (RELA)
   04668 TNF signaling pathway
    101102191 (RELA)
   04066 HIF-1 signaling pathway
    101102191 (RELA)
   04071 Sphingolipid signaling pathway
    101102191 (RELA)
   04024 cAMP signaling pathway
    101102191 (RELA)
   04151 PI3K-Akt signaling pathway
    101102191 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101102191 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101102191 (RELA)
   04218 Cellular senescence
    101102191 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101102191 (RELA)
   04621 NOD-like receptor signaling pathway
    101102191 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101102191 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101102191 (RELA)
   04625 C-type lectin receptor signaling pathway
    101102191 (RELA)
   04660 T cell receptor signaling pathway
    101102191 (RELA)
   04658 Th1 and Th2 cell differentiation
    101102191 (RELA)
   04659 Th17 cell differentiation
    101102191 (RELA)
   04657 IL-17 signaling pathway
    101102191 (RELA)
   04662 B cell receptor signaling pathway
    101102191 (RELA)
   04062 Chemokine signaling pathway
    101102191 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101102191 (RELA)
   04917 Prolactin signaling pathway
    101102191 (RELA)
   04926 Relaxin signaling pathway
    101102191 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101102191 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101102191 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101102191 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101102191 (RELA)
   05202 Transcriptional misregulation in cancer
    101102191 (RELA)
   05203 Viral carcinogenesis
    101102191 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101102191 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101102191 (RELA)
   05221 Acute myeloid leukemia
    101102191 (RELA)
   05220 Chronic myeloid leukemia
    101102191 (RELA)
   05215 Prostate cancer
    101102191 (RELA)
   05222 Small cell lung cancer
    101102191 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101102191 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101102191 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    101102191 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101102191 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101102191 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101102191 (RELA)
   04931 Insulin resistance
    101102191 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101102191 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101102191 (RELA)
   05135 Yersinia infection
    101102191 (RELA)
   05133 Pertussis
    101102191 (RELA)
   05134 Legionellosis
    101102191 (RELA)
   05152 Tuberculosis
    101102191 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101102191 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101102191 (RELA)
   05162 Measles
    101102191 (RELA)
   05164 Influenza A
    101102191 (RELA)
   05161 Hepatitis B
    101102191 (RELA)
   05160 Hepatitis C
    101102191 (RELA)
   05168 Herpes simplex virus 1 infection
    101102191 (RELA)
   05163 Human cytomegalovirus infection
    101102191 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101102191 (RELA)
   05169 Epstein-Barr virus infection
    101102191 (RELA)
   05165 Human papillomavirus infection
    101102191 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101102191 (RELA)
   05145 Toxoplasmosis
    101102191 (RELA)
   05140 Leishmaniasis
    101102191 (RELA)
   05142 Chagas disease
    101102191 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101102191 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101102191 (RELA)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101102191 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101102191
NCBI-ProteinID: XP_027815096
Ensembl: ENSOARG00000017426
LinkDB
Position
21
AA seq 555 aa
MDDFFPIIFSEEPVQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINF
EEFSPMVFPSGQIPSQTSALAPAPTPVLTQTPVLAPVPAPAPAPAPGMASTLAQALAPGL
AQAVTPPAPKTNQTGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQ
LLNQGVSMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSS
IADVDFSAFLSQISS
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggacgacttcttccccatcatcttctccgaagagcctgtgcaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc
cgctcagccggcagcatccctggcgagaggagcacagacaccaccaagacccaccccact
atcaagatcaatggctacacggggccagggacagtccgcatctccctggtcaccaaggac
cctcctcaccggcctcaccctcacgagctagtggggaaagactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagctttcagaacctggggatccagtgt
gtaaagaagcgggacttggagcaggccatcagccagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgtggggactacgacctgaatgccgtgcggctctgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctggcgcctgtcctctct
catcccatctttgacaaccgcgcccccaacaccgctgagcttaagatctgccgggtaaat
cggaactctgggagctgcctcggcggggacgagatcttcctgctgtgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctctttttca
caagctgacgtgcaccggcaagtggccatcgtgttccggacgccgccctatgcggacccc
agcctgcaggcccctgtgcgtgtctccatgcagctgcggcggccttctgatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag
aagcgcaaaaggacatacgagacctttaagagcatcatgaaaaagagccctttcaatgga
cccaccgacccccggcctccaacccggcgcatcgctgtgcctaaccgcggctcagcctcc
atccccaagccagctccccagccctattcctttacgccatctctcagcaccatcaacttt
gaggagttttcccccatggtctttccttctgggcagatcccaagccaaacctcggccttg
gcaccagcccccaccccggtcctgacccagaccccagtcctggccccggtcccagcccca
gccccagctccagccccaggcatggcatcaaccctggcccaggccctagccccaggcctg
gctcaggctgtgaccccgcctgcccccaagaccaaccagaccggggaagggacactgaca
gaggccctgctgcagctgcagtttgatgccgatgaagacctgggggctctgcttggcaac
aacactgaccctgctgtgttcacagacctggcatctgtcgacaactctgagtttcagcag
ttgttgaaccagggtgtatccatgggcccccacacagctgagcccatgctgatggagtac
cctgaggctataactcgcttggtgacagggtcccagaggccccctgacccagctcccact
cccctggggccccctgggctcaccaatggcctcctctcgggggatgaagacttctcctcc
atcgcggacgtggacttctcagcctttctgagtcagatcagctcctaa

DBGET integrated database retrieval system