KEGG   Ovis aries (sheep): 101102220Help
Entry
101102220         CDS       T03117                                 

Gene name
NPFF
Definition
(RefSeq) pro-FMRFamide-related neuropeptide FF
  KO
K05247  neuropeptide FF-amide peptide
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101102220 (NPFF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPFF
Motif
Other DBs
NCBI-GeneID: 101102220
NCBI-ProteinID: XP_004006339
Ensembl: ENSOARG00000016425
LinkDB All DBs
Position
3
AA seq 155 aa AA seqDB search
MELCISIAFSRFPLRRLWEVRNRGTAGIRGRCGHSKADGSMDARQAAVLLLVLLLVTDRS
HAEGPGSRDGGDQIFTEEDSGAHPPQDAQTPRSLLRSLLQAMQRPGRSPAFLFQPQRFGR
NTRGSWSNKRLSPRAGEGLSSPFWSLAAPQRFGKK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtgcatttccattgccttctctagattccccctcaggcggctgtgggaggtg
aggaacagggggacagcaggtataagaggcaggtgtggccacagcaaggcagacggcagc
atggacgccaggcaggcagcagtgctgctgctggtgctgctgttagtaacagacaggagc
cacgctgaaggaccggggagccgggatggaggagaccagatcttcacggaggaagacagt
ggtgcccacccaccacaggatgctcagacccccaggtcactcctgcgctccctgctccag
gccatgcagagacctggccggagtccagccttcctgtttcagccccagaggtttggcaga
aacacccggggctcctggagcaacaaaagactgagtccccgagctggagaggggctgagt
tcccccttctggagcctggctgcccctcagcgcttcgggaagaagtga

DBGET integrated database retrieval system