KEGG   Ovis aries (sheep): 101102503Help
Entry
101102503         CDS       T03117                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04020  Calcium signaling pathway
oas04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101102503 (CACNA1E)
   04020 Calcium signaling pathway
    101102503 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101102503 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101102503 (CACNA1E)
Ion channels [BR:oas04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101102503 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101102503
NCBI-ProteinID: XP_027831733
LinkDB All DBs
Position
12
AA seq 2311 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMARDSSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLSAHPSLYRRPRAIEGLALGL
GLEKCEEERVSRGGSLKGDGGDLASTLDSQRSPLALGKREPPWLARPCHGNCDPTQPEAG
SGETVVTFGDRARHRQSQRRSRHRRVRTEGREPSSTSRSRSASQERSLDETVPSEGERDR
EPRAGHGGKEPMIQEEERGRCQDLRRTNSLMVPRGSGLAGSLDEADTPLVPPQPELEVGK
DAALTEQEPEGSSEQALLGDVKLDMGRVSQSEPDLSCVTVNTDKATTESTSVTVTIPDVG
PLVDSTMVHISNKTDGEASPLKEEEIREDEEEVEKKQQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMP
KASDLTVGKIYAAMMIMDYYRQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVPGLSSRSAYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQP
SNHGIYLPSDTQEHAGSGKASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFS
MERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVS
RCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDSSTPRRSRRQ
LPPVPPKPRPLLSYSSLMRHAGSISPPADGSEGGSPLTSQALESNDAGLPESSNPRQSHP
SPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGH
YRRRRRGGPGPGMTCGAVSDLLSDTEEDDKC
NT seq 6936 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggcgatggagactcggac
cagagcaggaaccgacaaggaacccccgtgccggcctccgggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcctgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaattgcatcgtcttggccctggagcaacatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccctatttcattgggatcttttgctttgaagctggg
atcaaaatcgtggccctggggttcatcttccataagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggttctcagcggcatcctggctactgcgggaacccacttc
aacacccatgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaagctc
gtgtcggggatacctagcctacagattgtgttgaagtccatcatgaaggccatggtgcct
ctcctgcagattggccttctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagtggaaagttgcaccgagcctgcttcatgaataattcaggtattctagaa
ggatttgacccacctcacccatgtggcgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatccttttcgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttt
tttgttctcaacctcgtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccggagagccttcatgaaactgcggcgtcagcagcagatcgagcgtgagctg
aacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaacaaa
aatgctggaacgtcagccttagaagtgcttcggagggcaaccatcaaaaggagccggact
gaggccatggcacgggactccagcgacgagcactgcgtggacatctcctctgtgggcaca
cctcttgcccgagccagcatcaagagcgcaaaggtggacggggcctcctatttccggcac
aaggagcgacttttgcgtatctctatccgccacatggttaagtcccaggtgttttactgg
atcgtgctgagccttgtggctctcaacaccgcctgtgtggccatcgtccaccacaaccag
ccccagtggctcacccacctcctctactatgcagagtttctgtttctggggctcttcctt
ctagagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttccttc
aactgctttgactttggggtcacagtgggcagcatctttgaagtagtctgggccatcttc
agacctggtacatcttttggaatcagtgtcctgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctccggaatttggtggtctccttgatgagctccatg
aagtctatcatcagtttactcttcctcctcttcctcttcatcgttgtctttgctctgcta
ggaatgcagctgtttgggggcagattcaactttaatgatgggactccttcagcaaacttc
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcgcagggtggggtcagctcgggcatgtggtctgct
atctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaacgcccaggagctgaccaaggatgaacaagaagaagag
gaggccttcaaccagaagcatgcgctgcagaaggccaaggaggtcagcccgatgtctgcg
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtccgtgtgggagcag
cgaaccagccagctgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccgcccatgaaccccctcaaccccctcaacccactgagccccctcaacccgctc
agcgcgcaccccagcctctaccggaggccccgggccatcgaggggctggccctgggcctg
gggctggagaagtgtgaggaagagcgtgtcagccgcggggggtccctcaagggggacgga
ggggacttggcgagcaccctggacagccagaggagccccctggccctgggcaaacgggag
ccaccctggctggcccggccctgtcacgggaactgcgacccgacccagccagaggcgggc
agcggggagacggtggtgaccttcggggaccgggcccggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggaccgagggcagggagccctcctccacctccaggagcagg
tctgccagccaggagcggagtctggacgaaactgtgcccagcgagggtgagagggaccgc
gagcccagggccggccacgggggcaaagaacccatgatccaagaggaagagcgagggcga
tgccaggacttacgtaggaccaacagtctgatggtgcccagaggctccgggctggcagga
tccctggatgaggctgacacaccccttgtcccaccccagccagagctggaagtggggaag
gacgcagccctgacggagcaggagccggagggcagcagcgagcaggctctgttgggggac
gtgaagctggacatgggccgggtcagccagagcgaacctgacctctcctgtgtcacggtc
aacacggacaaggccaccaccgagagcaccagcgtcactgtcaccatccccgacgtgggc
cccttggtggattcaaccatggtgcacatcagcaacaagactgatggagaagccagtccc
ttgaaagaggaagagatcagagaggatgaagaggaggtagagaagaagcagcagaagaag
gagaagcgtgagacgggcaaagccatggtgccccacagctcgatgttcatcttcagcacc
accaacccgatccgcagggcctgccactacatcgtgaacctgcgctacttcgagatgtgc
atcctgctggtgattgcagccagcagcatcgccctggcggccgaggaccccgtcctgacc
aactcggagcgcaacaaagtgctgaggtactttgactacgtgttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgattctgcaggacggctcctacttc
cgagacctgtggaacatcctggactttgtggtggtggttggtgcattggtggcctttgct
ctggcgaatgctttgggaaccaacaagggtcgggatatcaagaccatcaagtccctgagg
gttctccgtgtcctgaggccgctgaagaccatcaagcgcctgcctaagctcaaggctgtc
ttcgactgtgtggtcacctccttgaaaaacgtcttcaacatactcattgtctataagctc
ttcatgttcatctttgctgtcatcgcggttcagcttttcaagggcaagttcttctactgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaa
aacaagatggaggtgaaaggccgagagtggaagcgccatgaattccattatgacaacatc
atctgggctctgctgactctcttcactgtctccacaggggaaggatggcctcaagtcttg
cagcactcggtcgatgtgacggaggaagaccgaggcccgagccgcagcaaccggatggag
atgtccatcttttatgtggtctacttcgtggtcttccctttcttctttgtcaacatcttt
gtggctctcatcatcatcaccttccaggagcaaggggacaaaatgatggaagagtgcagc
ctggagaagaatgagagggcgtgcatcgacttcgccatcagcgccaaaccgctcacccgc
tacatgccccagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctcca
tcctttgagtacaccatcatggccatgatcgccctgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgagctggccctgaagtacctaaatatcgccttcacc
atggtgttttccttggagtgtgtcctgaagatcattgcatttggcttcttgaactatttc
cgagacacctggaatatctttgacttcatcactgtgattggcagtatcacagaaattatt
ctgacggacagcaagctggtgaacacgagtggcttcaacatgagctttctgaagctcttc
cgggcggcccgcctcatcaagctgctgcgtcagggctacaccatccgcattttactgtgg
accttcgtgcagtcctttaaggcccttccctatgtctgccttctgatcgccatgcttttc
ttcatctatgccatcattgggatgcaggtctttggaaacataaagttagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgctcttcagg
agtgccacgggtgaggcctggcaggagataatgctgtcgtgtctcggggagaagggctgt
gagccggacaccactgcgccgtcggggcagagcgagagcgagcgctgtggcaccgacctg
gcctacgtgtacttcgtctccttcatcttcttctgctccttcctgatgctcaacctattc
gtggctgtcatcatggacaactttgagtacctgactcgggactcatccatcctggggcct
caccacctggacgagtttgtccgtgtctgggcagagtatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccgccgctaggcctcggc
aagagatgtccctccaaggtggcatataagaggttggtcttgatgaacatgccagtggcc
gaggacatgactgtccacttcacttccacactgatggctctaatccggacagctctggac
attaaaatcgccaaaggtggtgcagacaggcagcagctagactcagagctccagaaggag
accctggccatctggcctcacctgtcccagaagatgctggatctgctcgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactac
agacagagcaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcacccatg
ttccagcgcatggagccctcgtctctgcctcaggagatcattgctaatgccaaagccctg
ccttatctccagcaggaccccgtgccaggcctgagtagccggagtgcatacccttcgatg
agtccactctccccacaggaaatattccagttggcctgtatggacccagctgatgatgga
cagttccaggaacaacaatctctggagccagaggttagtgaattaaaaagcgtgcagccc
tctaaccatggcatctaccttccttcggacacccaggagcatgcgggctctgggaaggca
tcctctatgccacgcctgactgtggatccccaggtggtgacagatcccagctccatgaga
cgttcattttccaccattcgtgataagcgttcaaattcctcatggctggaggaattctcc
atggagcgaagcagcgaaaacacctacaagtcacggcgccggagttaccactcctccctg
aggctgtcagcccaccgtctgaactctgactcaggccacaagtccgacacccaccgctcc
gggggcagagagcggggacgatcgaaagagcgaaagcatcttctctctcctgacgtctcc
cgctgcaactccgaggagcgagggacccaggctgactgggagtccccggagcgccgtcag
tcccggtctcccagtgaaggcaggtcacagacccccaacagacagggcacagggtccctg
agtgagagctccatcccctccatctccgactccagcaccccacgacgaagtcggcggcag
ctcccaccggtccctcccaagcctcggcccctcctttcctacagctctctgatgagacac
gctgggagcatctccccaccagctgatgggagcgagggtggctccccactgacctcccaa
gctctggagagcaacgatgccggcctgcccgagtcttccaacccccggcagagccacccc
tccccacagcgctacatctccgagccctacctggccctgcacgaagactcccacgcctcg
gactgcggcgaggaggagacgctcacctttgaagcagccgtggccaccagcctgggccgg
tccaacaccattggctcggccccgcccctgcggcacagctggcagatgcccaacgggcac
tatcggcggcggaggcgcggggggcctggaccgggcatgacgtgcggagctgtcagcgac
ctcctgagtgacacggaagaagacgacaagtgctag

DBGET integrated database retrieval system