KEGG   Ovis aries (sheep): 101103084
Entry
101103084         CDS       T03117                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04012  ErbB signaling pathway
oas04015  Rap1 signaling pathway
oas04062  Chemokine signaling pathway
oas04137  Mitophagy - animal
oas04144  Endocytosis
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04510  Focal adhesion
oas04520  Adherens junction
oas04530  Tight junction
oas04540  Gap junction
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04625  C-type lectin receptor signaling pathway
oas04727  GABAergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas05100  Bacterial invasion of epithelial cells
oas05135  Yersinia infection
oas05152  Tuberculosis
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05219  Bladder cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101103084 (SRC)
   04015 Rap1 signaling pathway
    101103084 (SRC)
   04370 VEGF signaling pathway
    101103084 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101103084 (SRC)
   04137 Mitophagy - animal
    101103084 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101103084 (SRC)
   04520 Adherens junction
    101103084 (SRC)
   04530 Tight junction
    101103084 (SRC)
   04540 Gap junction
    101103084 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101103084 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101103084 (SRC)
   04613 Neutrophil extracellular trap formation
    101103084 (SRC)
   04625 C-type lectin receptor signaling pathway
    101103084 (SRC)
   04062 Chemokine signaling pathway
    101103084 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101103084 (SRC)
   04915 Estrogen signaling pathway
    101103084 (SRC)
   04917 Prolactin signaling pathway
    101103084 (SRC)
   04921 Oxytocin signaling pathway
    101103084 (SRC)
   04926 Relaxin signaling pathway
    101103084 (SRC)
   04919 Thyroid hormone signaling pathway
    101103084 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    101103084 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101103084 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    101103084 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101103084 (SRC)
   05203 Viral carcinogenesis
    101103084 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    101103084 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101103084 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101103084 (SRC)
   05152 Tuberculosis
    101103084 (SRC)
   05100 Bacterial invasion of epithelial cells
    101103084 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101103084 (SRC)
   05168 Herpes simplex virus 1 infection
    101103084 (SRC)
   05163 Human cytomegalovirus infection
    101103084 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101103084 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101103084 (SRC)
   01522 Endocrine resistance
    101103084 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101103084 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101103084 (SRC)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101103084 (SRC)
Protein kinases [BR:oas01001]
 Non-receptor tyrosine kinases
  SRC family
   101103084 (SRC)
Membrane trafficking [BR:oas04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101103084 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101103084 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101103084 (SRC)
  Macropinocytosis
   Kinases
    101103084 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 101103084
NCBI-ProteinID: XP_012044560
Ensembl: ENSOARG00000017940
UniProt: A0A6P7ENM6
LinkDB
Position
13
AA seq 548 aa
MGSNKSKPKDASQRRRSLEPAENTHGGGGGGGGGGGAFPSSQTPSKPASSDGHRGPNTAF
APAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIV
NNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNA
ENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFTSLQQ
LVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGT
WNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGS
LLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADF
GLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPG
MVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEP
QYQPGENL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagcct
gccgagaatacccacggaggcggcggtggtggaggcggcggtgggggtgccttcccctcc
tcacagacccccagcaagccagcctcctctgatggccaccgtggccccaacacggccttc
gcccctgcagccgctgagcccaagctgttcggaggcttcaactcctctgacacagtcacc
tccccgcagagggcggggcccctggctggcggagtgaccaccttcgtggccctctatgac
tatgagtcgcggacagagactgacctgtctttcaagaaaggggagcggcttcagattgtc
aacaacacgaggaaggtggatgtcagagagggagactggtggctggcccactcgctcagc
acaggacagacgggctacatccccagcaactatgtggcaccctctgactccatccaggct
gaagagtggtactttggcaagatcaccagacgggagtcagagcggttactgctcaatgca
gagaacccaagagggaccttcctagtgcgagaaagcgagaccacgaaaggcgcctactgc
ctctcggtgtccgacttcgacaatgccaagggcctcaacgtgaagcactataagatccgc
aagctggacagcggcggcttctacatcacctcccgcacccagttcaccagcctgcagcag
ctggtggcctactactctaaacacgctgacggcctctgccaccgcctcaccactgtgtgc
cccacgtctaagccgcagactcaaggcctggccaaggatgcctgggagatcccccgggag
tcactgcggctggaggtcaagctgggccagggctgcttcggagaggtgtggatgggtacc
tggaacggcaccaccagggttgccatcaaaaccctgaagcctggtacgatgtctccggag
gccttcctgcaggaggcccaggtcatgaagaaactgaggcatgagaaactcgtgcagctg
tacgccgtggtgtccgaagagcccatctacattgtcacggagtacatgagcaaggggagt
ttgctggactttctcaagggggagacaggcaagtacctgcggctgcctcagctggtggac
atggctgcacagattgcctcaggcatggcttatgtggaacggatgaactatgtccaccga
gacctccgggctgccaacatcctggttggagagagcctcgtgtgcaaagtggctgacttc
gggctggctcgactcattgaagacaacgaatacacagcccggcaaggtgccaaattcccc
atcaagtggacggctccggaagctgccctctatggccggttcaccatcaaatcagatgtg
tggtcctttgggatcctgctgacggagctcacgacaaagggacgggtgccctaccctggg
atggtgaaccgggaggtgctggaccaggtggagcggggctaccggatgccctgcccgcct
gagtgtcccgagtcattgcatgacctgatgtgccagtgctggcggaaggacccggaggaa
cggcccaccttcgagtacctgcaggccttcctggaggactatttcacgtccaccgagccc
cagtaccagcccggagagaacctatag

DBGET integrated database retrieval system