KEGG   Ovis aries (sheep): 101103187
Entry
101103187         CDS       T03117                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2-like
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04120  Ubiquitin mediated proteolysis
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04625  C-type lectin receptor signaling pathway
oas04919  Thyroid hormone signaling pathway
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101103187
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101103187
   04151 PI3K-Akt signaling pathway
    101103187
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101103187
  09143 Cell growth and death
   04110 Cell cycle
    101103187
   04115 p53 signaling pathway
    101103187
   04218 Cellular senescence
    101103187
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101103187
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101103187
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101103187
   05202 Transcriptional misregulation in cancer
    101103187
   05206 MicroRNAs in cancer
    101103187
   05205 Proteoglycans in cancer
    101103187
   05203 Viral carcinogenesis
    101103187
  09162 Cancer: specific types
   05214 Glioma
    101103187
   05220 Chronic myeloid leukemia
    101103187
   05218 Melanoma
    101103187
   05219 Bladder cancer
    101103187
   05215 Prostate cancer
    101103187
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101103187
   05169 Epstein-Barr virus infection
    101103187
   05165 Human papillomavirus infection
    101103187
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101103187
   01522 Endocrine resistance
    101103187
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101103187
   04121 Ubiquitin system [BR:oas04121]
    101103187
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101103187
Membrane trafficking [BR:oas04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101103187
Ubiquitin system [BR:oas04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101103187
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 101103187
NCBI-ProteinID: XP_004017965
Ensembl: ENSOARG00000013821
UniProt: A0A6P3EEB5 W5PWI5
LinkDB
Position
18
AA seq 491 aa
MCSTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLIVVSQQEPSDSGT
SVSDNRCHLEGGSNQKDLVQELQEEKPSSSDMVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGNMSEKAKLGDLMQEDEGFDVP
DCKKSTVSDSRESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREDTQ
DKEESMESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcagtaccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacttatactatgaaagaggttatattttatcttggccagtat
atcatgactaaacgattatatgatgaaaaacaacaacatattgtatattgttcaaatgat
cttctaggggatttgtttggagtcccaagcttctctgtgaaggagcacaggaaaatatat
acaatgatctacagaaatttgatagtagtcagtcagcaagaaccatcagattcaggcaca
tctgtgagtgataacaggtgtcaccttgaaggtgggagtaatcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatatggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacag
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcgacaggaactccatca
aatccggatctggatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaattcgaagttgagtctcttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggcgagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcatgcaatgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaaggaaaagataaagggaat
atgtctgagaaagccaaactaggagacttgatgcaagaagacgagggctttgatgtccct
gactgtaagaaatctacggtcagtgattccagagaatcatgtgttgaagaaaatgatgat
aaaatcacacaagcttctctgtctcaagaaagtgaggactattctcagccatcgacttct
aatagcatcatttatagtagccaagaagatgtcaaagagtttgagagagaagacacacaa
gacaaagaagaaagtatggagtctagttttccccttaatgccattgaaccttgtgtgatt
tgccagggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatctcatggca
tgctttacctgtgcaaagaagttaaaaaaaaggaataagccctgtccagtatgtaggcaa
ccaattcaaatgattgtgctaacttatttcccctag

KEGG   Ovis aries (sheep): 101104979
Entry
101104979         CDS       T03117                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04120  Ubiquitin mediated proteolysis
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04625  C-type lectin receptor signaling pathway
oas04919  Thyroid hormone signaling pathway
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101104979 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101104979 (MDM2)
   04151 PI3K-Akt signaling pathway
    101104979 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101104979 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    101104979 (MDM2)
   04115 p53 signaling pathway
    101104979 (MDM2)
   04218 Cellular senescence
    101104979 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101104979 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101104979 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101104979 (MDM2)
   05202 Transcriptional misregulation in cancer
    101104979 (MDM2)
   05206 MicroRNAs in cancer
    101104979 (MDM2)
   05205 Proteoglycans in cancer
    101104979 (MDM2)
   05203 Viral carcinogenesis
    101104979 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    101104979 (MDM2)
   05220 Chronic myeloid leukemia
    101104979 (MDM2)
   05218 Melanoma
    101104979 (MDM2)
   05219 Bladder cancer
    101104979 (MDM2)
   05215 Prostate cancer
    101104979 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101104979 (MDM2)
   05169 Epstein-Barr virus infection
    101104979 (MDM2)
   05165 Human papillomavirus infection
    101104979 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101104979 (MDM2)
   01522 Endocrine resistance
    101104979 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101104979 (MDM2)
   04121 Ubiquitin system [BR:oas04121]
    101104979 (MDM2)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101104979 (MDM2)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101104979 (MDM2)
Ubiquitin system [BR:oas04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101104979 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 101104979
NCBI-ProteinID: XP_004006527
Ensembl: ENSOARG00000000570
UniProt: A0A6P3TEP4
LinkDB
Position
3
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLIVVSQQEPSDSGT
SVSDNRCHLEGGSNQKDLVQELQEEKPSSSDMVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGNMSEKAKLGDLMQEDEGFDVP
DCKKSTVSDSRESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQ
DKEESMESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacttatactatgaaagaggttatattttatcttggccagtat
atcatgactaaacgattatatgatgaaaaacaacaacatattgtatattgttcaaatgat
cttctaggggatttgtttggagtcccaagcttctctgtgaaggagcacaggaaaatatat
acaatgatctacagaaatttgatagtagtcagtcagcaagaaccatcagattcaggcaca
tctgtgagtgataacaggtgtcaccttgaaggtgggagtaatcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatatggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacag
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcgacaggaactccatca
aatccggatctggatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaattcgaagttgagtctcttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggcgagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcatgcaatgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaaggaaaagataaagggaat
atgtctgagaaagccaaactaggagacttgatgcaagaagacgagggctttgatgtccct
gactgtaagaaatctacggtcagtgattccagagaatcatgtgttgaagaaaatgatgat
aaaatcacacaagcttctctgtctcaagaaagtgaggactattctcagccatcgacttct
aatagcatcatttatagtagccaagaagatgtcaaagagtttgagagagaagaaacacaa
gacaaagaagaaagtatggagtctagttttccccttaatgccattgaaccttgtgtgatt
tgccagggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatctcatggca
tgctttacctgtgcaaagaagttaaaaaaaaggaataagccctgtccagtatgtaggcaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system