KEGG   Ovis aries (sheep): 101103308
Entry
101103308         CDS       T03117                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin-1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04640  Hematopoietic cell lineage
oas05146  Amoebiasis
oas05166  Human T-cell leukemia virus 1 infection
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101103308 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101103308 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101103308 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101103308 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101103308 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101103308 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101103308 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oas04050]
    101103308 (IL1R2)
   04090 CD molecules [BR:oas04090]
    101103308 (IL1R2)
Cytokine receptors [BR:oas04050]
 Interleukin receptor families
  IL1 receptor family
   101103308 (IL1R2)
CD molecules [BR:oas04090]
 Proteins
  101103308 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Ig_5 Ig_4 Izumo-Ig
Other DBs
NCBI-GeneID: 101103308
NCBI-ProteinID: XP_012029110
Ensembl: ENSOARG00000013159
UniProt: A0A6P3TPE3
LinkDB
Position
3
AA seq 396 aa
MFLLSVLIMGVSTFAVHVGAAGSCRFHGRHPKTRFQLEGEPLVLRCPQVLHWESTSAHVN
VTWRRNDSAAAGPAEEESRVWVQDGALWIVPASRADSGSYICTTRNASYCDKMSVELRVF
EKTDASVPLIFYPQIIPLSASGLLVCPDLSEFIGNNADVKIQWYKDSVPLDQDNQKFLSV
RGTRLLVNNVSMEDAGYYTCAMPYAHKGRQYNITRNIKLQVKKREEETIPVIISPHQTIS
ASLGSRLTIPCKVFLGAGIHTTTLLWWTANNTRIEDAYHGGRVTEGERQAYSENNENYVE
VPLIFDPVRREDLHTDFRCAVRNTMSSQTLRTMVKEAATFSWEIMLAPLSFIVLVLGGIW
MHRRYKRRTGKAYGLMELKTGHPDSQSYPSKIKEIK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgttcctcttgtccgtattgataatgggtgtgtccaccttcgccgtgcacgtgggggcc
gcaggaagctgccgatttcatgggaggcaccccaaaacgaggttccagctagaaggggag
cctttggtcttgaggtgcccccaggtgctccactgggagtctaccagcgcccatgtcaac
gtgacttggcgtaggaatgactccgccgcagcaggcccagcggaagaagagtcgcgcgtg
tgggtccaagacggagctctctggatcgtgccagcctcccgggcagactccggctcctac
atctgcaccaccagaaatgcctcttactgtgacaaaatgtccgttgagctcagggttttc
gagaagacagacgcctcggtgcctctcatcttctacccacaaattatacccttgtcagcc
tctgggctactagtttgtcctgatctgagcgagttcatcggtaacaatgctgatgtgaag
attcagtggtacaaggattctgtccctttggatcaagacaaccagaagtttctcagtgtg
aggggaactcgcttactggtaaacaatgtgtccatggaggacgcaggctactatacctgt
gccatgccgtatgcccacaaaggcaggcaatacaacatcaccaggaatatcaaactccaa
gttaagaaacgagaggaggagaccattcctgtgatcatctctccccaccagaccatctca
gcctcgctggggtcaaggctgacaatcccatgtaaggtgtttctgggagccggcatacac
acaaccactctgctgtggtggacggccaacaacacccgcatagaggacgcctaccacggg
ggccgcgtgaccgagggggagcgccaggcatactcagaaaacaatgagaactacgttgag
gtgccactgattttcgatcctgtcagaagagaggatttgcacacggattttagatgtgct
gtccgtaacacaatgagttcccagacgcttcgtaccatggtcaaagaagccgccacgttc
tcctgggagatcatgcttgcccccctgtccttcatcgtcttggttctggggggcatatgg
atgcacagacggtataaacgcagaactggcaaagcctatggtttgatggagttaaagact
ggccatccagactcgcaatcctatccgagtaaaataaaggaaataaaatag

DBGET integrated database retrieval system