KEGG   Ovis aries (sheep): 101103632Help
Entry
101103632         CDS       T03117                                 

Gene name
PLA2G2C
Definition
(RefSeq) putative inactive group IIC secretory phospholipase A2 isoform X1
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101103632 (PLA2G2C)
   00565 Ether lipid metabolism
    101103632 (PLA2G2C)
   00590 Arachidonic acid metabolism
    101103632 (PLA2G2C)
   00591 Linoleic acid metabolism
    101103632 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    101103632 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101103632 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101103632 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    101103632 (PLA2G2C)
   04975 Fat digestion and absorption
    101103632 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101103632 (PLA2G2C)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101103632 (PLA2G2C)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101103632 (PLA2G2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Motif
Other DBs
NCBI-GeneID: 101103632
NCBI-ProteinID: XP_012008756
Ensembl: ENSOARG00000009381
UniProt: W5PHZ6
LinkDB All DBs
Position
2
AA seq 255 aa AA seqDB search
MWEEGQERASRKCQLTWVKEHWSGGGSELVPASARVTGRPPVPLSLRPVCTAQPGGHGPT
VSKAPRLQQSPGTVPFRQRTSAGRALGNRERCGCGSLGRLSSSGMKVFGVIVVFASCLMA
PMHSSFWQFQRMVKHITGRSAFFSYYGYGCYCGLGGKGTPVDNTDRCCLAHDCCYERAKH
LGCQPVLNGYQFRVVNGTVVCECALGPGVSCLCGLRACECDTQSAYCFKENLPTYEKNFK
QLSSRPHCGKHKLQC
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaggaggggcaagaaagagcctctagaaagtgccaattgacttgggtgaaagag
cactggtctgggggaggctcagagctggttccggcctctgccagagtcacaggacgtccg
cctgtccctctcagtctgcgtccggtctgtactgcccagccaggaggacatggcccaacg
gtttccaaggcccctcggcttcagcagagcccgggaaccgtcccattccggcaacggact
tcagcgggcagagccctcggaaacagagaacggtgtggttgtggctccttgggccgcctg
agctcctcgggaatgaaggtcttcggggttatcgtggtctttgcttcctgcttgatggcc
cccatgcacagcagcttctggcagtttcaaaggatggtcaagcacatcacagggcggagt
gccttcttctcatattatggatatggctgctactgcgggcttgggggcaaggggaccccc
gtggataacactgacaggtgctgcctggcccatgactgctgctacgagagggcgaagcac
cttggctgccagcccgtgttgaatggctaccagttccgtgtggtcaacgggaccgtggtc
tgtgaatgtgcccttggtcctggcgtcagctgcctctgtgggctgcgggcctgcgagtgt
gacactcagtctgcctactgcttcaaagagaacctgcccacctacgagaagaacttcaag
cagctctccagccggccccactgcggcaagcacaaactccagtgctag

KEGG   Ovis aries (sheep): 101104134Help
Entry
101104134         CDS       T03117                                 

Gene name
PLA2G2E
Definition
(RefSeq) group IIE secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101104134 (PLA2G2E)
   00565 Ether lipid metabolism
    101104134 (PLA2G2E)
   00590 Arachidonic acid metabolism
    101104134 (PLA2G2E)
   00591 Linoleic acid metabolism
    101104134 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    101104134 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101104134 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101104134 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    101104134 (PLA2G2E)
   04975 Fat digestion and absorption
    101104134 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101104134 (PLA2G2E)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101104134 (PLA2G2E)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101104134 (PLA2G2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 101104134
NCBI-ProteinID: XP_027819799
LinkDB All DBs
Position
2
AA seq 142 aa AA seqDB search
MKRPPLLTFLCLLVALAGGNLVQFGVMIERTTGKPALQYNDYGCYCGVGGARWPVDETDW
CCHAHDCCYGRLEKLGCEPKMERYLFSATRHSIFCAGRTSCQRRTCECDKKAALCFRRNL
GTYDRKYAHYPNKLCTGPTPPC
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggccccctcttctgaccttcctatgcctcctggtggccctggctggcgggaac
ctggtccagttcggggtgatgatcgagaggacgacggggaagcccgcgctgcagtacaat
gactacggctgctactgcggggtcggcggcgcccgctggccggtggacgagacagactgg
tgctgccacgcccacgactgctgctacgggcgcctggagaagcttggctgcgaacccaag
atggaaaggtacctcttctccgccaccaggcacagcatcttctgcgccggcagaaccagc
tgccagcgacggacctgcgagtgtgacaagaaggctgcgctctgctttcgccgcaacctg
ggcacctacgaccgcaaatacgcccattaccccaacaagctgtgcaccgggcccaccccc
ccctgctaa

KEGG   Ovis aries (sheep): 101106664Help
Entry
101106664         CDS       T03117                                 

Gene name
PLA2G2F
Definition
(RefSeq) group IIF secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101106664 (PLA2G2F)
   00565 Ether lipid metabolism
    101106664 (PLA2G2F)
   00590 Arachidonic acid metabolism
    101106664 (PLA2G2F)
   00591 Linoleic acid metabolism
    101106664 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    101106664 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101106664 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101106664 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    101106664 (PLA2G2F)
   04975 Fat digestion and absorption
    101106664 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101106664 (PLA2G2F)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101106664 (PLA2G2F)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101106664 (PLA2G2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Motif
Other DBs
NCBI-GeneID: 101106664
NCBI-ProteinID: XP_014949218
LinkDB All DBs
Position
2
AA seq 196 aa AA seqDB search
MPDGAPANPKGCKKKGLVRHPPGRRGPSIRTSSRTSRSRLRMKSFITITILASSVLPAAH
SSLLNLKSMVETVTGRNAILSFVGYGCYCGLGGRGLPMDEVDWCCHAHDCCYQKLFDLGC
HTYVDHYDYTIENSTTIVCSELNQTECDKQTCECDRSVALCFQQQTYREEHRNYLNIYCQ
GPTPRCSIYEPPPAPP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccagatggggctccagccaaccccaaagggtgcaagaagaaggggctggttagacac
ccccctgggaggaggggcccaagcatcaggacctcttcaagaacttctagatctcgcctg
aggatgaagagtttcatcaccatcaccatcctagccagcagcgtcctgcctgcggcccac
agcagcctgctcaacctcaagtccatggtggaaacagtcactgggaggaatgccatcttg
tccttcgtgggctacggctgctactgcgggctggggggccgtggcctgcccatggatgag
gtggactggtgctgccatgcccacgactgctgctaccagaagctctttgacctgggctgc
cacacctatgtggaccactatgactacaccattgagaacagcactaccatcgtctgcagc
gagctcaaccagaccgagtgtgacaagcaaacgtgcgagtgtgacaggagcgtggctctg
tgcttccagcagcagacgtacagggaggagcaccgcaactatctcaacatctactgccag
ggccccacaccccgctgcagcatctacgagccgccccccgcgcctccctag

KEGG   Ovis aries (sheep): 101106916Help
Entry
101106916         CDS       T03117                                 

Definition
(RefSeq) group IID secretory phospholipase A2 isoform X1
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101106916
   00565 Ether lipid metabolism
    101106916
   00590 Arachidonic acid metabolism
    101106916
   00591 Linoleic acid metabolism
    101106916
   00592 alpha-Linolenic acid metabolism
    101106916
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101106916
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101106916
  09154 Digestive system
   04972 Pancreatic secretion
    101106916
   04975 Fat digestion and absorption
    101106916
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101106916
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101106916
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101106916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 101106916
NCBI-ProteinID: XP_004005211
Ensembl: ENSOARG00000009461
UniProt: W5PI86
LinkDB All DBs
Position
2
AA seq 146 aa AA seqDB search
MGLPLLCVLLVFAGVAPAEGDMLDLNKMVKQVTGKTPIFFYSSYGCYCGFGGQGQPRDAT
DWCCHEHDCCYGNLTPHDCDYRYDHYDYTFFRGKVQCSTKGSWCEQQLCACDKTLAFCLQ
RNLNTYKSHLRHLSGCEGEIPKCHTL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccccctgctctgcgtgctgctggtctttgctggtgtggctccagctgagggc
gacatgctggacctgaacaagatggtcaaacaagtgacggggaagacccccatcttcttc
tattcgtcctacggctgctactgcggatttggtggccaaggccaacccagagatgccaca
gactggtgctgccacgaacacgactgctgctatggtaacctgacaccccacgactgtgac
taccgctatgaccactatgactacacctttttccgggggaaagtccagtgttccaccaag
gggagctggtgtgagcaacagctgtgcgcctgtgacaagacgttggctttctgcctccag
cggaacctgaacacctacaagagtcacctgcgtcatctgtccgggtgcgagggcgagatc
cccaagtgccacaccctctag

KEGG   Ovis aries (sheep): 101107171Help
Entry
101107171         CDS       T03117                                 

Definition
(RefSeq) phospholipase A2, membrane associated-like
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101107171
   00565 Ether lipid metabolism
    101107171
   00590 Arachidonic acid metabolism
    101107171
   00591 Linoleic acid metabolism
    101107171
   00592 alpha-Linolenic acid metabolism
    101107171
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101107171
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101107171
  09154 Digestive system
   04972 Pancreatic secretion
    101107171
   04975 Fat digestion and absorption
    101107171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101107171
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101107171
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101107171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 101107171
NCBI-ProteinID: XP_004005212
LinkDB All DBs
Position
2
AA seq 144 aa AA seqDB search
MKTLLLLAVIMAFALLQVQAYLWDFAAMIKHTTGKGAVSNYGAYGCYCGLGGRGTPKDAT
DWCCWEHDCCYKKLKYHGCGTKFLGYNVSIRRGQIICENQGVCRRIVCECDKKAAICFAK
TQNTYNRKLQKYSNLLCTGRAPKC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccttctgctgctggcagtgatcatggccttcgcccttcttcaggtccaggca
tatttgtgggatttcgcggcaatgatcaagcacacaacaggaaagggagccgtgtccaat
tatggtgcctacggctgctactgtggactgggtggcagaggaacccccaaggacgcaacg
gattggtgctgttgggaacatgactgctgttacaaaaagctgaagtatcatgggtgtggc
accaagttcctgggatacaatgtgtccatccgccggggccaaatcatctgtgagaatcaa
ggtgtgtgtagacgtatagtctgtgaatgtgataaaaaagctgccatctgttttgcaaag
acccagaacacctataatagaaagctccaaaagtacagcaacttactgtgcacagggcgc
gccccgaagtgctga

KEGG   Ovis aries (sheep): 101107420Help
Entry
101107420         CDS       T03117                                 

Definition
(RefSeq) phospholipase A2, membrane associated
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101107420
   00565 Ether lipid metabolism
    101107420
   00590 Arachidonic acid metabolism
    101107420
   00591 Linoleic acid metabolism
    101107420
   00592 alpha-Linolenic acid metabolism
    101107420
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101107420
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101107420
  09154 Digestive system
   04972 Pancreatic secretion
    101107420
   04975 Fat digestion and absorption
    101107420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101107420
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101107420
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101107420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 101107420
NCBI-ProteinID: XP_027821386
Ensembl: ENSOARG00000009488
LinkDB All DBs
Position
2
AA seq 144 aa AA seqDB search
MKTLLLLAVIMAVGLLQVHGSLLDFRKMIKFATGKEPATNYSFYGCYCGMRGRGTPKDAT
DRCCRAHECCYRNLESRGCRTRFLKYNATYEEDQIICEDTDDCKSQVCQCDKIAASCFAT
NLKTYNKKLRFYSKRRCRGPTPQC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcctgctgctggcagtgattatggccgtcggcctgctgcaggtccatgga
agtttgctggatttccggaaaatgatcaagttcgcgacaggaaaggaacctgcgaccaat
tatagcttctacggctgctactgtggaatgcgcggcagaggaacccccaaggatgcaaca
gatcggtgttgcagggcacatgagtgctgctacagaaacctggagagccgcgggtgccgc
accaggttcctgaaatacaacgccacttatgaagaggaccaaatcatctgcgaggacacg
gatgactgtaagagtcaagtgtgtcaatgtgataaaatagctgccagttgctttgcaaca
aacctgaaaacctacaacaagaagctgcgtttctacagcaagcgtcggtgccgagggccc
accccccagtgctga

KEGG   Ovis aries (sheep): 101107675Help
Entry
101107675         CDS       T03117                                 

Definition
(RefSeq) phospholipase A2, membrane associated-like
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101107675
   00565 Ether lipid metabolism
    101107675
   00590 Arachidonic acid metabolism
    101107675
   00591 Linoleic acid metabolism
    101107675
   00592 alpha-Linolenic acid metabolism
    101107675
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101107675
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101107675
  09154 Digestive system
   04972 Pancreatic secretion
    101107675
   04975 Fat digestion and absorption
    101107675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101107675
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101107675
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101107675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 101107675
NCBI-ProteinID: XP_004005214
Ensembl: ENSOARG00000009502
UniProt: W5PID3
LinkDB All DBs
Position
2
AA seq 144 aa AA seqDB search
MKTLLLLAVIIAIGLLQGHGSLADFQKMVKFTTGKDLLTTYSFYGCHCGAGNRGTPKDAT
DRCCRARDCCYENLRKRGCRTSFQSYNFIFQRGQIVCGDQDYCKRHLCQCDKKAADCFDK
NRRTYNKKFQYYNNLLCFGSAPKC
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcctgctgctggcagtgatcatagccatcggcctgctgcagggccatgga
agtttggcagatttccagaaaatggtcaagttcacgacaggaaaggaccttctgaccact
tacagcttctatggttgccactgtggtgcgggtaacagaggaacccccaaggacgcaaca
gatcggtgctgcagggcacgtgactgctgctacgaaaacctaagaaaacgcggatgccgc
accagcttccagagctacaactttattttccaacggggccaaatcgtttgtggcgatcag
gactactgtaagcgccatctgtgtcaatgtgataaaaaagctgccgattgctttgataaa
aaccggaggacctacaataaaaaattccaatactacaacaaccttctgtgctttgggagt
gcccccaagtgctga

KEGG   Ovis aries (sheep): 101109935Help
Entry
101109935         CDS       T03117                                 

Definition
(RefSeq) group 10 secretory phospholipase A2 isoform X2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101109935
   00565 Ether lipid metabolism
    101109935
   00590 Arachidonic acid metabolism
    101109935
   00591 Linoleic acid metabolism
    101109935
   00592 alpha-Linolenic acid metabolism
    101109935
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101109935
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101109935
  09154 Digestive system
   04972 Pancreatic secretion
    101109935
   04975 Fat digestion and absorption
    101109935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101109935
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101109935
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101109935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Motif
Other DBs
NCBI-GeneID: 101109935
NCBI-ProteinID: XP_004021226
Ensembl: ENSOARG00000007761
UniProt: W5PD13
LinkDB All DBs
Position
24
AA seq 159 aa AA seqDB search
MAPLPLCPMVGLFLLLLLGSGPRLRAAPQRSHVHRRGLIGLAGTIDCVGPRPALVYVKYG
CFCGLGGHGQPQDAIDWCCHAHDCCYTHAENSGCSPKLQPYSWNCVNQTVKCEPTEDKCQ
ELICKCDQEFAYCLARTEYNIKYLFYPNFLCGNYSPECD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctccgctgcctttgtgcccgatggtagggctgtttctgctgctgctcctgggatct
ggacccaggctcagagcagctccccagaggtcacatgtgcaccgacgtgggctcatagga
ctggccgggactatcgactgtgttggccctcgccctgccttggtctatgtgaaatatggc
tgcttttgtggtctggggggccatggccagccccaggatgccatagactggtgctgtcat
gcacacgactgctgctatacacatgccgagaactccggctgcagtcccaagttgcagccc
tactcctggaattgtgtcaatcagactgtcaagtgtgaaccaacggaggacaagtgccaa
gaactcatatgcaagtgtgaccaggagtttgcttactgcttagcccgaacagagtacaac
attaagtacctcttctatcccaatttcttgtgtgggaactattcacccgagtgtgactga

KEGG   Ovis aries (sheep): 101113959Help
Entry
101113959         CDS       T03117                                 

Gene name
PLA2G3
Definition
(RefSeq) group 3 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101113959 (PLA2G3)
   00565 Ether lipid metabolism
    101113959 (PLA2G3)
   00590 Arachidonic acid metabolism
    101113959 (PLA2G3)
   00591 Linoleic acid metabolism
    101113959 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    101113959 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101113959 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101113959 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    101113959 (PLA2G3)
   04975 Fat digestion and absorption
    101113959 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101113959 (PLA2G3)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101113959 (PLA2G3)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101113959 (PLA2G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_2 Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 101113959
NCBI-ProteinID: XP_011953455
Ensembl: ENSOARG00000009594
LinkDB All DBs
Position
17
AA seq 510 aa AA seqDB search
MGVLVALLRVLSFLGVVPGGSPALHLHTTSCHLVRPIASIPLGSLSFLGKDVQGRALFHA
RWDGHGRLQVCSRQDEPELTAAFRALCAGELTRGSFIHTPGPELQRALAILQSQWEACQG
PAESPAGTREKRAAGQSGEPGIRHQRVKRGWTMPGTLWCGVGDSARNSTELGVFEGPDLC
CQEHDYCPQTVSPFQYNYGIRNYRFHTISHCSCDARFQQCLQNQRDSVSDIVGVVFFNVL
AIPCFVLEEQEACVEWYWWGGCRRYGSVPLARLQPRTLYNASWSSPAIPSTPSPQNTAPS
QPQLMQRPQKWPAQQRESRHPSQAKATALQAPVASPGPAMLPRVQLEVTDPGLQGPQGVH
QACRSFRHLDRCEHQIGPQETKFQLFNSAWDPLFHCNCTRRLARFLRFYNPPVGAIMLQE
LLGMTCFKLAPPLDCAEVKDCSSDPRAIRVSAWHLRQLQQRRRQLQGSSAHHRQARPSEH
PKAPTSFYDRCLQLTQGAGRPKGQQKPWNQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggggttctggtggcactgttgagggtgctgagcttcctgggagtggttccgggaggc
tcccctgccctgcacttgcacaccacctcctgccacttggtcaggcccatcgccagcatc
cctttgggatccctgagcttcctgggcaaggatgtccagggacgagctctgttccatgcc
cgctgggatgggcacgggagattgcaggtgtgtagccggcaggatgagccagagctcact
gcagccttccgtgcgctctgtgctggtgagctcacccggggctccttcatccacacccct
ggacctgagctgcagagagccctggccatccttcagagccagtgggaggcctgccaaggg
cctgctgagagtccagcggggaccagggagaagcgagccgcaggacagagtggagagcct
ggcatccggcaccagcgggtgaagaggggctggactatgcctggcacgctgtggtgtgga
gtcggggactctgccaggaactccacggagctgggggtcttcgagggccctgatctctgc
tgccaggaacatgactactgcccccagacggtctcacccttccagtacaactacggcatc
cggaactaccgattccacaccatctcccactgcagctgtgatgccaggttccagcagtgc
ctgcagaaccagcgggactccgtctccgacatcgtgggcgtggtcttcttcaacgtgctg
gcgatcccttgctttgtgctggaggagcaggaggcctgtgtggagtggtactggtggggc
gggtgtagaaggtacggctctgtgcccctcgctcgtcttcagcccaggaccctctacaat
gcctcttggagctcccctgccatcccctcaactcccagcccccagaacacagcccccagc
cagcctcagctgatgcagcgtcctcagaagtggccagcacagcagagagagtccaggcac
cccagtcaagccaaggccacagccctccaggcccctgtggcctcccctgggcctgccatg
ctccccagagtccagctagaggtcaccgatccaggcctccaggggcctcagggtgtccac
caggcctgccgcagcttccgccacctggaccggtgtgagcatcagatcgggccccaggag
accaagttccagctgttcaacagcgcctgggaccccctcttccactgcaactgcacacgc
cggctggcccgcttcctgaggttctacaacccacccgtgggtgccatcatgcttcaggag
ctgctgggaatgacctgcttcaaattggcccctccgctggactgtgctgaggtcaaagac
tgttccagtgaccccagggccataagagtgtcagcttggcacctgcggcaacttcagcag
aggcgacgccagctccaggggtcgagcgctcaccacaggcaggcaaggccttcagagcac
ccaaaggcccccacgtcattctacgaccggtgcctgcagctgacccaaggagctggaaga
cccaaagggcagcagaaaccctggaaccagtga

KEGG   Ovis aries (sheep): 101115852Help
Entry
101115852         CDS       T03117                                 

Gene name
PLA2G12B
Definition
(RefSeq) group XIIB secretory phospholipase A2-like protein isoform X1
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101115852 (PLA2G12B)
   00565 Ether lipid metabolism
    101115852 (PLA2G12B)
   00590 Arachidonic acid metabolism
    101115852 (PLA2G12B)
   00591 Linoleic acid metabolism
    101115852 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    101115852 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101115852 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101115852 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    101115852 (PLA2G12B)
   04975 Fat digestion and absorption
    101115852 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101115852 (PLA2G12B)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101115852 (PLA2G12B)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101115852 (PLA2G12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2G12
Motif
Other DBs
NCBI-GeneID: 101115852
NCBI-ProteinID: XP_004021507
Ensembl: ENSOARG00000007339
UniProt: W5PBQ5
LinkDB All DBs
Position
25
AA seq 195 aa AA seqDB search
MTRAISFLILWLSLAGGLAQSDSSPDAEESYSDWGLRHIRDSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCSSYFLGLKVPERMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEVACDSLADTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggccatcagcttcttgattttgtggctcagcctggctggtggcctggctcag
agcgacagcagccctgacgcagaggagtcctattcagactggggccttcggcacatccgg
gacagctttgaatctgtcaacagctacttcgattcctttctggaactgctgggagggaaa
aatggagtctgtcagtacaggtgccgatacggaaaggcaccaatgcccagacctggctac
aagcctcaggagcccaatggctgcagctcctatttcctgggtctcaaggtaccagaaaga
atggacttgggtattccagcaatgaccaagtgctgcaaccagctggacgtctgttacgac
acttgtggtgccaacaagtatcgctgcgatgcaaaattccgatggtgcctccactctatc
tgctctgaccttaaacggagtttgggctttgtctccaatgtggaagtagcctgtgattcc
ctggctgatactgtgttcaacactgtatggactttgggctgccggccctttatgaacagt
cagcgggcagcttgcatctgtgcagaagaggagaaagaagagttgtga

KEGG   Ovis aries (sheep): 101117700Help
Entry
101117700         CDS       T03117                                 

Gene name
PLA2G1B
Definition
(RefSeq) phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101117700 (PLA2G1B)
   00565 Ether lipid metabolism
    101117700 (PLA2G1B)
   00590 Arachidonic acid metabolism
    101117700 (PLA2G1B)
   00591 Linoleic acid metabolism
    101117700 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    101117700 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101117700 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101117700 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    101117700 (PLA2G1B)
   04975 Fat digestion and absorption
    101117700 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101117700 (PLA2G1B)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101117700 (PLA2G1B)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101117700 (PLA2G1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2
Motif
Other DBs
NCBI-GeneID: 101117700
NCBI-ProteinID: XP_004017463
Ensembl: ENSOARG00000012036
UniProt: W5PR24
LinkDB All DBs
Position
17
AA seq 145 aa AA seqDB search
MRLLVLAALLTVGAGQAGLNSRALWQFNGMIKCKIPSSEPLLDFNNYGCYCGLGGSGTPV
DDLDRCCQTHDNCYKQAKKLDSCKVLVDNPYTNSYSYSCSNKQITCSSENNACEAFICNC
DRNAAICFSEVPYNNEHKNLDKKYC
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagactcctggtgttggctgctctgctcacagtgggcgctggccaggccggcctcaac
tcgagggcgttatggcagttcaacggcatgatcaagtgcaagatccccagcagtgagcca
ctgctagatttcaacaactacggctgctattgtggcctgggtggatcagggacccctgtg
gatgatctggacaggtgctgccagacacacgacaactgctacaaacaagccaagaaactg
gacagctgtaaagtcctcgtggacaatccctacaccaacagctactcatactcatgttct
aacaaacagatcacctgcagcagcgaaaacaatgcctgtgaggccttcatctgcaactgt
gaccgtaatgctgccatctgcttctcagaggtgccgtacaacaacgagcacaagaacctg
gacaagaagtactgctag

KEGG   Ovis aries (sheep): 101119561Help
Entry
101119561         CDS       T03117                                 

Gene name
PLA2G12A
Definition
(RefSeq) group XIIA secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101119561 (PLA2G12A)
   00565 Ether lipid metabolism
    101119561 (PLA2G12A)
   00590 Arachidonic acid metabolism
    101119561 (PLA2G12A)
   00591 Linoleic acid metabolism
    101119561 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    101119561 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101119561 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101119561 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    101119561 (PLA2G12A)
   04975 Fat digestion and absorption
    101119561 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101119561 (PLA2G12A)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101119561 (PLA2G12A)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101119561 (PLA2G12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2G12
Motif
Other DBs
NCBI-GeneID: 101119561
NCBI-ProteinID: XP_004009672
Ensembl: ENSOARG00000005623
UniProt: W5P6I1
LinkDB All DBs
Position
6
AA seq 185 aa AA seqDB search
MALLAVLLVLFLTAAGRCQEQAQTTDWRATLKTIRNGVHKIDMYLNAALDLLGGEDGLCQ
YKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDC
DEAFQSCLSKICRDVQKTLGLAQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCRYE
EKTDL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcgccgtcctcctggtcctcttcttgaccgccgctgggaggtgccaggag
caagcccagaccaccgactggagggccaccctgaagaccatccggaacggcgttcacaag
attgacatgtacctgaacgccgccctggacctgctgggaggcgaggacgggctctgccag
tataagtgcagtgacggatctaagcctttcccgcgttatggatataaaccctccccaccg
aatggatgtggctccccactgtttggtgttcatcttaacatcggcatcccttccctgaca
aagtgctgcaaccaacatgaccggtgctatgagacctgcggcaaaagcaaaaacgactgt
gacgaggcgtttcagtcttgcctgtccaagatttgcagagatgtgcagaaaacactgggg
ctggctcagcacgtgcaggcctgtgaaaccaccgtggaactcttgtttgacagcgttata
cacttaggctgtaagccgtacttggacagccaacgagccgcgtgtaggtgtcgctacgaa
gagaaaaccgatctttga

KEGG   Ovis aries (sheep): 101120062Help
Entry
101120062         CDS       T03117                                 

Gene name
PLA2G5
Definition
(RefSeq) calcium-dependent phospholipase A2 isoform X2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101120062 (PLA2G5)
   00565 Ether lipid metabolism
    101120062 (PLA2G5)
   00590 Arachidonic acid metabolism
    101120062 (PLA2G5)
   00591 Linoleic acid metabolism
    101120062 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    101120062 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101120062 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101120062 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    101120062 (PLA2G5)
   04975 Fat digestion and absorption
    101120062 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101120062 (PLA2G5)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101120062 (PLA2G5)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101120062 (PLA2G5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Motif
Other DBs
NCBI-GeneID: 101120062
NCBI-ProteinID: XP_004022971
Ensembl: ENSOARG00000000994
UniProt: W5NS89
LinkDB All DBs
Position
2
AA seq 138 aa AA seqDB search
MKGLFMLAWLLACSVPAVPGSLLDLKSMIEKVTGKPALKSYGFYGCHCGWGGRGTPKDGT
DWCCWKHDRCYAQLETQDCDVLTQAYRYRVAWGFVICEHGSRCQRQLCACDQKFVYCLKR
NMRSYNPLYQYFPNFLCT
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcctcttcatgctggcttggctcctggcttgcagtgtgcctgctgtcccaggg
agcttgctggacctgaagtcgatgattgagaaggtgactggaaagcccgccctgaagagc
tatggcttctacggctgtcactgtggctgggggggccgcggcacccccaaggatgggact
gattggtgctgttggaagcatgaccgctgctacgcccagctggagacacaagactgcgac
gtcttgacacaggcctacagatacagggtcgcatggggcttcgtcatctgcgaacatggg
tcccgctgccagcggcagctctgtgcctgcgatcagaaattcgtctactgcctgaaaaga
aacatgaggagctacaaccctctttatcagtactttcccaacttcctctgcacctag

KEGG   Ovis aries (sheep): 105605991Help
Entry
105605991         CDS       T03117                                 

Gene name
PLA2G2D
Definition
(RefSeq) group IID secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas00564  Glycerophospholipid metabolism
oas00565  Ether lipid metabolism
oas00590  Arachidonic acid metabolism
oas00591  Linoleic acid metabolism
oas00592  alpha-Linolenic acid metabolism
oas01100  Metabolic pathways
oas04014  Ras signaling pathway
oas04270  Vascular smooth muscle contraction
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105605991 (PLA2G2D)
   00565 Ether lipid metabolism
    105605991 (PLA2G2D)
   00590 Arachidonic acid metabolism
    105605991 (PLA2G2D)
   00591 Linoleic acid metabolism
    105605991 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    105605991 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105605991 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105605991 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    105605991 (PLA2G2D)
   04975 Fat digestion and absorption
    105605991 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    105605991 (PLA2G2D)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     105605991 (PLA2G2D)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    105605991 (PLA2G2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1
Motif
Other DBs
NCBI-GeneID: 105605991
NCBI-ProteinID: XP_027821384
LinkDB All DBs
Position
2
AA seq 146 aa AA seqDB search
MGLSLLCVLLVFAGVAPAEGDMLDLNKMVKQVTGKTPIFFYSSYGCYCGIGGQGQPRDAT
DWCCHEHDCCYRHLKSDKCDIIFNHYHYTFFRGNVQCSTKGSWCQQQLCACDKTLAFCLQ
RNLNTYKSQLRYLSRCKGETPKCHTL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctccctgctctgcgtgctgctggtctttgctggtgtggctccagctgagggc
gacatgctggacctgaacaagatggtcaaacaagtgacggggaagacccccatcttcttc
tattcgtcctacggctgctactgcggaattggtggccaaggccaacccagagatgccaca
gactggtgctgccacgaacacgactgctgctaccgtcacctcaaatctgacaaatgtgac
atcatcttcaaccactaccactacacctttttccgggggaacgtccagtgttccaccaag
gggagctggtgtcagcagcagctgtgcgcctgtgacaagacgttggccttctgcctccag
cggaacctgaacacctacaagagtcagctgcgttatctgtccagatgcaagggcgagacc
cccaagtgccacaccctctag

DBGET integrated database retrieval system