KEGG   Ovis aries (sheep): 101103648Help
Entry
101103648         CDS       T03117                                 

Gene name
WHSC1
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase NSD2 isoform X1
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
oas  Ovis aries (sheep)
Pathway
oas00310  Lysine degradation
oas05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101103648 (WHSC1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101103648 (WHSC1)
Enzymes [BR:oas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101103648 (WHSC1)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101103648 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H PHD_2 zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 101103648
NCBI-ProteinID: XP_014952157
LinkDB All DBs
Position
6
AA seq 1284 aa AA seqDB search
MEFSVRKSPLSAPKVAKCMKMKQAPEVLGSANGKTPSCDVSRECSVFLSKAQLSAGLQDG
VVQKFNGHDALPFIPAERLKDLTSRVFNGEPGAHDAKLRFESQEVKGLGTPPHTTPVKNG
SPEIKLKITKTYMNGKPLFESSICGDGAAAVSRSEADGQRPEHKARRSRKRSAQRGSLLE
HGRGEAALVSRVSSPVDKKVPAKRESCLNSSRDEGQPLRFGVGDLVWSKVSGYPWWPCMV
SADPLPPQPTHTRLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESA
KQAPTKAERIKLLKPISGKLRAQWEMGLVQAEAAARMAVEERRAKFTFLYVGDQLRLNPH
VAKEAGVAAESLGEAAEPSAQRVAEADPGGGAGSPPGRKKATASTPRSRRGNAASRFLVF
CQKHRDEVVAEHPDASAEEIEELLASQWSMLNEKQRARYHTKFALAAPPQPEEDSGNFSG
KRRSHAKRTQGLSGDTEAEEAPRKRLRTDRLGLRKREAITDKAARTSSCKALEAASSLKS
QAATKHLSDACKPLKKRHRAPAAAAAALTFSKSSSPSASLTEHEVSDGPGDEPPGVPADE
SADETQTEASISSKRSERGATARKEHVCQLGEEPGSLVLCEGPCCGAFHLACLGLSRRPE
GRSRGTHSCFVCKESKSDVKRCVVSQCGKFYHEACVRRFPLTVFESRGFRCPLHSCLSCH
ASNPSNPRPSKGKMLRCVRCPVAYHGGDACLAAGCSVIASNSIICTNHFTARKGKRHHAH
VNVSWCFVCSKGGSLLCCESCPAAFHPDCLSIDMPDGSWFCNDCRAGKKLHFQDIIWVKL
GNYRWWPAEVCHPKNVPPNIQKMKHEVGEFPVFFFGSKDYYWTHQARVFPYMEGDRGRGS
RYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERRPPPYKHIKVNKPYGKVQVH
TADISEIPKCNCKPTDENPCGSESQCLNRMLMFECHPQVCPAGESCQNQCFTKRQYPETK
IVRTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKRAHENDITHFYMLTIDKDR
IIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGN
EKTVCRCGASNCSGFLGDRPKTSAPLSSEEKGKKTKKKARRRRTKGEGKKPSEDECFRCG
DGGQLVLCDRKSCTKAYHLPCLGLGKRPFGGSGVGAPGLCGAVGGVLPAAVRREPQGPGP
RPEGGRHTSLDRKLGAADRPADRR
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atggaattcagcgtcaggaaaagccctctttctgctccaaaggtggcaaagtgcatgaag
atgaagcaggccccggaagtcctgggcagcgccaacgggaagaccccgagctgcgatgtg
agccgcgagtgctccgtgttcctgagcaaagcccagctctcggccggcctgcaggacggg
gttgtgcagaagttcaacggccacgacgcgctgccattcatcccggctgagaggctgaaa
gacctcacctcccgcgtcttcaatggagagcctggtgctcacgatgccaaactacgtttt
gaatcccaggaagtgaagggacttgggaccccacctcacactacccctgtcaaaaatggc
tctccggaaattaagctgaaaatcaccaaaacctacatgaatgggaaacctctctttgag
tcctccatatgtggcgacggtgcggccgccgtgtcccgttcggaagcagacggacagaga
ccggagcacaaggcccggaggagccgcaagagaagcgcacagcgtggctctttgctggag
cacggccgcggggaggccgccctagtgtccagggtctccagtcctgtggacaaaaaggtt
ccagctaagagagagtcctgtctgaacagcagcagagacgaaggccagccgttgaggttc
ggggtcggggacctggtgtggtccaaggtgtccggctacccgtggtggccctgcatggtc
tctgccgacccgctccccccccagcccacccacacaaggctgaaaggtcagaaaaagagt
gcacgccagtatcacgtacagttctttggtgatgccccagaaagagcttggatatttgag
aagagccttgtagcttttgaaggagaaggccagtttgaaaaattatgccaggaaagtgcc
aagcaggcgcccacgaaagctgagagaatcaagctgttgaagcccatttcagggaagttg
agggcccagtgggaaatgggcctcgttcaggccgaggccgccgcgcgcatggcggtggag
gagcggagggccaagttcacgttcctctacgtgggggaccagctccgcctcaacccccat
gtggccaaggaggcgggggtggctgcggagtcgctgggagaagcggcagagccctcagca
cagagggtggctgaggccgaccccggggggggcgcgggatccccccccggcaggaagaag
gccacggcctccaccccgaggagtcggaggggcaacgcggcgtcccggttcctggtcttc
tgtcagaagcacagggacgaggtggtcgccgagcacccggacgcctctgccgaggagatc
gaggagctgctggcctcgcagtggagcatgctcaacgagaagcagagggcgcgctatcac
accaagtttgcgctcgcggctccgccccagcccgaggaagactctggtaacttcagtggg
aagagaaggagccatgcgaagaggacccagggcctgagcggagacactgaggctgaggag
gcccccaggaagaggcttaggaccgacaggctcggcctgcggaagagagaggcgatcact
gacaaagcagcccgcacgagctcctgcaaggcccttgaggcggcgtcctcgctgaagagt
caggcagccacgaaacacctgtctgacgcctgcaagcccctgaagaagcgccaccgggcc
ccggcagcggccgccgccgccctcaccttcagcaaaagctcgtctccttccgcctcctta
actgagcacgaggtctcggacggccccggagacgagccccccggagttcccgcggacgaa
agcgcggacgaaacccagaccgaggcgtccatctcctctaagaggtcggagcggggggcc
accgccaggaaggagcacgtgtgccagctcggcgaggagccgggcagcctggtgctgtgc
gagggtccctgctgcggcgccttccacctggcctgcctaggcctctcccgccggcccgaa
gggcggtcgcgagggacccactcgtgcttcgtgtgtaaggagagcaagagtgacgtcaag
cgctgcgtggtgtcgcagtgtgggaagttctaccacgaggcctgcgtgcgcaggttcccc
ctgacggtgttcgagagccggggcttccgatgcccgcttcacagctgcctgagttgccac
gcctccaacccctcgaacccaaggccctcgaaaggtaagatgctgcggtgcgtccggtgc
cccgtcgcctaccacggaggggatgcgtgtctggcagcgggctgctcggtgattgcgtcc
aacagcatcatctgcacgaaccatttcaccgcccggaagggcaagaggcaccacgcgcac
gtcaacgtgagctggtgcttcgtgtgctccaaaggggggagcctgctgtgctgcgagtcc
tgcccggcggccttccaccctgactgcctgagcatcgacatgccggacggcagctggttc
tgcaacgactgcagggccgggaagaagctgcacttccaggacatcatctgggtgaagctc
gggaactacagatggtggccggcagaagtttgccatcccaaaaatgtccccccaaatatt
cagaaaatgaagcacgaggttggagaattccctgtgtttttctttgggtctaaagattat
tactggacgcatcaggcgcgagtgttcccgtacatggagggggaccgggggcggggcagc
cgctaccagggggtcagagggatcggaagagtcttcaaaaacgcactgcaagaagctgaa
gcccgtttccgtgaaatcaaacttcaaagggaagccagagagacgcaggagagcgagcgc
aggcccccgccctacaagcacatcaaggtgaacaagccctacgggaaggtgcaagtccac
acggcggacatctccgagatccccaagtgcaactgcaagcccaccgacgagaacccgtgc
ggctcggagtcgcagtgtctgaaccgcatgctcatgtttgagtgccacccgcaagtgtgc
cccgcgggcgagtcctgccagaaccagtgcttcaccaagcgccagtaccccgagaccaag
atcgtcaggacggacggcaagggctggggcctggtggccaagagggacatcaggaagggg
gagtttgtgaacgagtacgtgggcgagctgattgacgaggaggagtgcatggcgaggatc
aagcgtgcgcacgagaacgacatcacacacttctacatgctcaccatagacaaggaccgc
atcatcgacgccggccccaaggggaattactcccggttcatgaaccacagctgccagccc
aactgcgagaccctcaagtggacggtgaacggggacacgcgcgtgggcctgttcgccgtg
tgtgacatccctgcagggacagagctgaccttcaactacaacctcgactgtctgggcaac
gagaagacggtgtgtcgctgcggagcctccaactgcagcggcttcctcggcgacaggccg
aagacgtcagcacccctgtcctcggaggagaagggcaagaagaccaagaaaaaggccagg
aggcgccgcacgaagggcgaagggaagaagccgtccgaggacgagtgcttccgctgcggg
gacggcggccagttggtgctgtgcgaccgcaagtcctgcaccaaggcctaccacctgccc
tgcctgggcctgggcaagcggcccttcggtgggtcgggggtgggtgctccaggtctctgc
ggggcggtggggggggtgctgcccgctgctgtcaggagggagccccaaggccctggcccc
agaccggagggaggcagacacacgagcctggacagaaagctgggggcggcggacaggccg
gcggacagacggtag

DBGET integrated database retrieval system