KEGG   Ovis aries (sheep): 101103933Help
Entry
101103933         CDS       T03117                                 

Gene name
EDN2
Definition
(RefSeq) endothelin-2
  KO
K16367  endothelin-2
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04270  Vascular smooth muscle contraction
oas04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101103933 (EDN2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101103933 (EDN2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101103933 (EDN2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101103933 (EDN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin SecG
Motif
Other DBs
NCBI-GeneID: 101103933
NCBI-ProteinID: XP_004001901
Ensembl: ENSOARG00000020360
LinkDB All DBs
Position
1
AA seq 177 aa AA seqDB search
MPTALCSIALALLVALHEGKSQAATTPIPEQPAPLPRARGSHLRTRRCSCSSWLDKECVY
FCHLDIIWVNTPGQTAPYGLGNPPRRRRRSLPRRCECYSARDPACATFCHQRPWTDAVAV
PRSGSPVAAFQDGKTRATAGELLQRLRVISATKIHFARQQQKTKRETRSTHSRQRKR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgccttgtgctccatcgctctagccctgctagtggccctgcacgaaggcaag
agccaggccgctaccacccccatcccagagcaaccagcgcccttgccccgggcccgaggc
tcccacctgcggactcgacgctgctcctgcagctcctggctcgacaaggagtgcgtctac
ttttgccacctggacatcatctgggtgaacactcccggacagacagctccttacggcctg
ggaaacccgccaagacgccggcgccgctctctgccaagacgctgtgaatgctacagtgcc
agggaccctgcctgtgccaccttctgccatcaaaggccctggacggatgcggtggcagtc
ccacgcagtgggtcccctgtagctgcattccaggatggcaagacgcgggccacggcagga
gagctcctccagcgcctgagggttatttctgcaaccaagatccactttgctaggcaacag
cagaagacgaagagggagaccagatctacacactccaggcagaggaagagatag

KEGG   Ovis aries (sheep): 101114458Help
Entry
101114458         CDS       T03117                                 

Gene name
EDN3
Definition
(RefSeq) endothelin-3 precursor
  KO
K05227  endothelin-3
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04270  Vascular smooth muscle contraction
oas04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101114458 (EDN3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101114458 (EDN3)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101114458 (EDN3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101114458 (EDN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin
Motif
Other DBs
NCBI-GeneID: 101114458
NCBI-ProteinID: NP_001267620
UniProt: R9THX7
LinkDB All DBs
Position
13
AA seq 212 aa AA seqDB search
MELGLCFLFGLAVTSAAGWVPHPQSGDAGRSSMPRAPSAARSEGDTKETVATMAVRGPSP
RSPWREQGPSQFGKQGAEGVPVHHRARRCTCFTYKDKECVYYCHLDIIWINTPERTVPYG
LSSYRGSGSRGRRSAGQFPQSPQPVKGTLRCACTESDDDACLQFCTWSLAARGNSRSAQT
PDKEVEKHTGGALGGVRPRSCALVATLRLLSS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagctggggctgtgcttccttttcgggctcgctgtgacctccgccgcaggatgggtg
cctcacccccagtctggggatgctggcaggagcagcatgccccgggccccctctgcagcc
agatcggagggggacaccaaggagacggtggccaccatggcagtccggggtccaagcccc
agaagcccttggcgggagcagggaccaagtcagtttgggaagcagggggccgagggggtc
cctgtgcaccaccgagcccggcgctgtacatgttttacctacaaggacaaagagtgcgtc
tactattgccacctggacatcatctggatcaacactcctgaacggactgtgccctatgga
ctgtccagctacagaggcagcggaagcaggggcaggaggtcggctgggcagttcccgcag
agcccacagccggtgaaggggacactgcgctgtgcctgcacggagagcgatgatgatgcc
tgcttgcagttctgcacctggtccctggctgcccgcgggaattcaaggtcggcacaaaca
cctgacaaagaagtggaaaagcacactggtggtgccctggggggtgtgcgtccgaggagc
tgcgctctagtggctacgctgagattactgagcagctga

KEGG   Ovis aries (sheep): 443498Help
Entry
443498            CDS       T03117                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1 precursor
  KO
K16366  endothelin-1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04066  HIF-1 signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04270  Vascular smooth muscle contraction
oas04668  TNF signaling pathway
oas04916  Melanogenesis
oas04924  Renin secretion
oas04926  Relaxin signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05200  Pathways in cancer
oas05410  Hypertrophic cardiomyopathy (HCM)
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    443498 (EDN1)
   04066 HIF-1 signaling pathway
    443498 (EDN1)
   04024 cAMP signaling pathway
    443498 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443498 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    443498 (EDN1)
   04916 Melanogenesis
    443498 (EDN1)
   04924 Renin secretion
    443498 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    443498 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443498 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    443498 (EDN1)
   05410 Hypertrophic cardiomyopathy (HCM)
    443498 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    443498 (EDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin Glyco_transf_20
Motif
Other DBs
NCBI-GeneID: 443498
NCBI-ProteinID: NP_001009810
Ensembl: ENSOARG00000014073
UniProt: Q9BG76
LinkDB All DBs
Position
20
AA seq 202 aa AA seqDB search
MDYFPMIFALLFVAFQGAPEAAVLGTELSTGAESGGERPVPTTPWRPRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPSRSKRSLKDFFPTKATVHRKRCQCASQTDKKC
QNFCQAGKELKDQDSMEKAWDNRKRGKDCPKLGEKCLQQQLVVGRKTRRLETISNSIKTS
FRVAKLKAQLYRDKKVIYSRAH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggattatttccccatgatttttgctctgctgtttgtggctttccaaggagctccagaa
gcagcagtcctgggcaccgagctcagcacgggagcggagagtggcggggagaggccggtt
cccaccacgccctggagaccccgcaggtccaagcgctgctcctgctcgtccctgatggat
aaagagtgtgtctacttctgccacctggacatcatctgggtcaacactccagagcacgtt
gttccatatggactcggaagcccttctaggtccaagcgctccttaaaggacttctttcct
acaaaggcgacagtccacaggaagagatgccagtgtgctagccagacagacaagaaatgt
cagaatttttgccaagcaggaaaagagctcaaggaccaagactccatggagaaagcctgg
gacaaccgaaagagaggaaaagactgtcctaagctaggagagaagtgtcttcagcagcag
ctcgtggtcggaaggaaaacaagaaggttggagaccatcagcaacagcatcaaaacatct
tttcgtgttgccaagctgaaagcccagctctatagagataagaaagtgatctacagccgt
gctcactga

DBGET integrated database retrieval system