KEGG   Ovis aries (sheep): 101103949
Entry
101103949         CDS       T03117                                 

Gene name
XPA
Definition
(RefSeq) DNA repair protein complementing XP-A cells isoform X1
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    101103949 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101103949 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101103949 (XPA)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101103949 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N zf-CpG_bind_C zf_C2H2_13 Zn-ribbon_8 SMBP zf-dskA_traR
Other DBs
NCBI-GeneID: 101103949
NCBI-ProteinID: XP_004004281
Ensembl: ENSOARG00000011207
UniProt: W5PNI2
LinkDB
Position
2
AA seq 273 aa
MAAAGEASSEPAASEQPTELSASVRASIERKRQRALMLRQARLAARPYPATAAATTGGMA
NVKAAPKIIDTGGGFILEEEEEEEHAVGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLATCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQKNREKMKQKKFDKKVKELRRAVRSSVWKKQTV
AHQHEYGAEENLEDDMYRKTCTVCGHELTYEKM
NT seq 822 nt   +upstreamnt  +downstreamnt
atggccgccgccggggaagcttcgtcggagccggcggcttcagaacaaccaacggaactg
tctgcctcagtgcgggcgagcatcgagcggaagcggcagcgggcgctgatgctgcgccag
gcccggctggcggcccggccttacccggcgacggcagctgcaactactggaggcatggct
aatgtaaaagcagccccaaagataattgacacaggaggaggcttcatcctggaggaggaa
gaagaggaagaacatgcagttgggaaagttgttcatcaaccaggacctgttatggaattt
gattatgttatatgtgaagaatgtggtaaagagttcatggattcttaccttatgaaccac
tttgatttggcaacttgtgataattgcagagatgctgatgataaacacaagcttataact
aaaacagaagcaaaacaagaataccttctgaaagattgtgatttagaaaaaagagaacca
gcgcttaaatttattgtgaagaagaatcctcatcattcacagtggggtgatatgaaactc
tacttaaaactacagattgtgaagaggtctcttgaagtttggggtagtcaggaagcatta
gaagaagcgaaggaagttcgacagaaaaatcgagaaaaaatgaaacagaagaagtttgat
aaaaaagtaaaagaattacggcgagcagtaagaagcagtgtatggaaaaagcaaacagtt
gctcatcaacatgagtatggggctgaagaaaacctagaggatgacatgtaccggaagact
tgtactgtgtgtggccatgaactgacatatgagaaaatgtga

DBGET integrated database retrieval system