KEGG   Ovis aries (sheep): 101104173Help
Entry
101104173         CDS       T03117                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03410  Base excision repair
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101104173 (LIG1)
   03410 Base excision repair
    101104173 (LIG1)
   03420 Nucleotide excision repair
    101104173 (LIG1)
   03430 Mismatch repair
    101104173 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101104173 (LIG1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101104173 (LIG1)
Enzymes [BR:oas01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101104173 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101104173 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101104173 (LIG1)
DNA replication proteins [BR:oas03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101104173 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101104173 (LIG1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101104173 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101104173 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     101104173 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 DDR PucR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 101104173
NCBI-ProteinID: XP_027834351
LinkDB All DBs
Position
14
AA seq 958 aa AA seqDB search
MERLGPQPEGLLAASPALLCGCRNRKLVAREEEEGGENSDTIMQRSIRSFFQPKKEGKVK
KPEKETSNSIRETESPPKVALKERNRVVSDGDSPVKRPGRKATRVLGSEGEEEEEEAPTT
PRSQEPASDSPQPSPPSLVTLPESSPSRSKPSPAVASPSWIPKRRTARKQLPKRTFQDVL
KEQGEDEDPETKKKKEEGEAETPTESLPEPEGGDKEEVEGGDQPTTPPEPQTSTESPTES
VSEPGVTVKQEPQEDGQAQPPPKAPKTLSSFFSPRKPAVKKEAKEGGPGALRKDETKGHL
DPPSYNPAKNNYHPIEDACWKAGQRVPYLAVARAFEKIEEVSARLRMVETLSNLLRSVVA
LSPADLLPVLYLSLNRLGPPQQGLELGIGEGILLKAVAQATGRQLESVRAEVAEKGDVGL
VAESSRSTQRLVLPPPALTAGGVFAKFRDIAQLAGSASTTKKMDVIKGLFVACRHSEARF
IARALSGRLRLGLAEQSVLAALAQAVSLTPPGQECPPVVVDAGKGKTAEARKTWLEEQGM
ILKQTFCEVPDLDRIVPVLLEHGLERLPEHCRLSPGVPLKPMLAHPTRGVSEVLKRFEEA
AFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGRYPDIISRIPKIKLPSVTSFILDTE
AVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYLNGESLVREPLSRRRQL
LRENFVETEGEFVFATSLDTKDTEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHN
WLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGRYGGFLLASYDEESEEFQAICKLGTGFS
DEELEEHHQRLQALVLPTPRSYVRADGAVAPDHWLDPSDVWEVKCADLSLSPIYPAARGL
VDSEKGISLRFPRFIRVREDKKPEQATTSAQVAGLYKKQSQIQNQQGAEPDSEQEEFY
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcttggaccgcaacccgaaggactcctggcggccagtcccgctctactctgc
ggttgcaggaacaggaaactggtggccagagaggaggaggaggggggagagaattctgat
accatcatgcagcgaagcatcaggtcatttttccagcccaagaaagagggcaaagtgaag
aagccagagaaggagacctccaacagcatcagagaaacggagtcccctccgaaggtggca
ctgaaggagcggaatcgagtggtgtctgacggtgactctccagtgaagaggccggggagg
aaggcaaccagggtcctgggcagtgagggcgaggaggaggaagaggaagcccccaccacc
cccagaagccaggagcctgcttcagactctccacagccctcacctcccagtcttgtcaca
ctgcctgagagcagcccttcccgctccaagccctccccagcggttgcgtccccatcatgg
atcccgaagcgtcgcacggcccggaagcagcttcccaaacggacatttcaagatgtcctg
aaagagcagggtgaggacgaggacccggagactaagaagaagaaggaggaaggagaagca
gagacaccaacagaaagcctcccagagcctgaagggggcgacaaggaggaagtggaaggc
ggggaccagcccacgacgccccctgagccccagacctccacagagtccccgacagaaagc
gtttcagagcccggggtgacagtgaagcaggaaccacaggaggatggccaggctcaaccg
ccccccaaagctccaaagaccctcagcagtttcttctccccccggaagccagctgtcaaa
aaagaagcgaaagaaggaggacctggtgctctaagaaaggacgagaccaagggacacctg
gacccaccgagctacaatcctgccaagaacaactaccaccccatcgaggatgcctgctgg
aaggcaggccagagggttccttatctggctgtggcccgggcgttcgagaagatcgaggag
gtctctgctcggctccggatggtggagacgctgagcaacctgctgcgctccgtggtggcc
ctgtcacctgctgacctcctacccgtcctctacctcagcctcaaccgcctggggccgccc
cagcagggcctggagctcggcatcggagagggcatcctcctcaaggcagtggcccaggcc
acgggtcggcagctggagtccgtccgggccgaggtggccgagaagggtgatgtggggctg
gtggccgagagcagccgcagcacccagaggctcgtgctgcccccacccgcgctcaccgcc
ggcggcgtcttcgccaagttccgggacatcgcgcagctggcgggcagcgcttccaccacc
aagaagatggatgtcatcaaaggcctctttgtggcctgccgtcactcagaggcgcgtttc
attgccagagccctgagtggacggctgcgcctcgggctggctgagcagtcggtgctggcg
gcccttgcccaggccgtgagcctcacgccccccggccaagaatgcccccccgtcgtggtg
gacgccgggaagggcaagacggcagaagccagaaagacgtggctggaggagcaaggcatg
atcctgaagcagaccttctgtgaggtacctgacctggaccggatcgtccccgtgctgctg
gaacacggcctcgagcggctcccggagcactgcaggctgagcccaggggttcccctgaaa
ccaatgttggcccaccccacccggggtgtcagcgaggtcctgaagcgctttgaggaggca
gctttcacctgcgaatacaaatatgacgggcagagggcacagattcacgttctggaaggt
ggggaggtgaagatcttcagcaggaatcaggaggacaatactggaaggtaccctgacatc
atcagccgcatccccaagattaaactcccatcagtcacatccttcatcctagacacagaa
gctgtagcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacccgc
aaacgcaaggaggtggacgcggcagagatccaggtgcaggtgtgtctgtatgccttcgat
ctcatctacctcaacggagagtccctggtacgtgagcccctctcccgacgccggcagctg
ctccgggagaacttcgtggagacggagggcgagttcgtctttgccacctccctggacacc
aaggacacggagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgagggg
ctgatggtgaagaccctggacgtggacgccacctacgagatcgccaagaggtcacacaac
tggctcaagctgaagaaggactacctcgagggtgtgggcgacaccctggacctcgtagtg
attggtgcctacctgggcaaggggaaacgggccggccggtacggaggcttcctgctggcc
tcgtacgatgaggagagcgaggagttccaggccatctgcaagctcggaactggcttcagt
gacgaggagctggaagagcatcaccagaggctccaggccttagtgctgcccaccccgcgc
tcctatgtccgggctgacggcgcggtggcccccgaccactggctggaccccagcgacgtg
tgggaggtgaagtgcgcggacctctccctgtcccccatctaccctgcggcccggggcctg
gtggacagtgagaaggggatctccctccgcttcccccggtttattcgtgtccgtgaggac
aagaagccggagcaggccactactagtgcccaggtggccggtctgtacaagaagcagagt
cagattcagaaccagcagggtgctgagccggactccgagcaggaagagttctattag

DBGET integrated database retrieval system