Ovis aries (sheep): 101104357 Help Entry 101104357         CDS       T03117                                  Gene name HRAS Definition (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism oas  Ovis aries (sheep) Pathway oas01521   EGFR tyrosine kinase inhibitor resistance oas01522   Endocrine resistance oas04010   MAPK signaling pathway oas04012   ErbB signaling pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04062   Chemokine signaling pathway oas04068   FoxO signaling pathway oas04071   Sphingolipid signaling pathway oas04072   Phospholipase D signaling pathway oas04137   Mitophagy - animal oas04140   Autophagy - animal oas04144   Endocytosis oas04150   mTOR signaling pathway oas04151   PI3K-Akt signaling pathway oas04210   Apoptosis oas04211   Longevity regulating pathway oas04213   Longevity regulating pathway - multiple species oas04218   Cellular senescence oas04360   Axon guidance oas04370   VEGF signaling pathway oas04371   Apelin signaling pathway oas04510   Focal adhesion oas04540   Gap junction oas04550   Signaling pathways regulating pluripotency of stem cells oas04625   C-type lectin receptor signaling pathway oas04630   JAK-STAT signaling pathway oas04650   Natural killer cell mediated cytotoxicity oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04664   Fc epsilon RI signaling pathway oas04714   Thermogenesis oas04720   Long-term potentiation oas04722   Neurotrophin signaling pathway oas04725   Cholinergic synapse oas04726   Serotonergic synapse oas04730   Long-term depression oas04810   Regulation of actin cytoskeleton oas04910   Insulin signaling pathway oas04912   GnRH signaling pathway oas04915   Estrogen signaling pathway oas04916   Melanogenesis oas04917   Prolactin signaling pathway oas04919   Thyroid hormone signaling pathway oas04921   Oxytocin signaling pathway oas04926   Relaxin signaling pathway oas04929   GnRH secretion oas04933   AGE-RAGE signaling pathway in diabetic complications oas04935   Growth hormone synthesis, secretion and action oas05010   Alzheimer disease oas05022   Pathways of neurodegeneration - multiple diseases oas05034   Alcoholism oas05132   Salmonella infection oas05160   Hepatitis C oas05161   Hepatitis B oas05163   Human cytomegalovirus infection oas05165   Human papillomavirus infection oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05170   Human immunodeficiency virus 1 infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05205   Proteoglycans in cancer oas05206   MicroRNAs in cancer oas05210   Colorectal cancer oas05211   Renal cell carcinoma oas05213   Endometrial cancer oas05214   Glioma oas05215   Prostate cancer oas05216   Thyroid cancer oas05218   Melanoma oas05219   Bladder cancer oas05220   Chronic myeloid leukemia oas05221   Acute myeloid leukemia oas05223   Non-small cell lung cancer oas05224   Breast cancer oas05225   Hepatocellular carcinoma oas05226   Gastric cancer oas05230   Central carbon metabolism in cancer oas05231   Choline metabolism in cancer oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101104357 (HRAS)    04012 ErbB signaling pathway     101104357 (HRAS)    04014 Ras signaling pathway     101104357 (HRAS)    04015 Rap1 signaling pathway     101104357 (HRAS)    04370 VEGF signaling pathway     101104357 (HRAS)    04371 Apelin signaling pathway     101104357 (HRAS)    04630 JAK-STAT signaling pathway     101104357 (HRAS)    04068 FoxO signaling pathway     101104357 (HRAS)    04072 Phospholipase D signaling pathway     101104357 (HRAS)    04071 Sphingolipid signaling pathway     101104357 (HRAS)    04151 PI3K-Akt signaling pathway     101104357 (HRAS)    04150 mTOR signaling pathway     101104357 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101104357 (HRAS)    04140 Autophagy - animal     101104357 (HRAS)    04137 Mitophagy - animal     101104357 (HRAS)   09143 Cell growth and death    04210 Apoptosis     101104357 (HRAS)    04218 Cellular senescence     101104357 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101104357 (HRAS)    04540 Gap junction     101104357 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101104357 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101104357 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101104357 (HRAS)    04650 Natural killer cell mediated cytotoxicity     101104357 (HRAS)    04660 T cell receptor signaling pathway     101104357 (HRAS)    04662 B cell receptor signaling pathway     101104357 (HRAS)    04664 Fc epsilon RI signaling pathway     101104357 (HRAS)    04062 Chemokine signaling pathway     101104357 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101104357 (HRAS)    04929 GnRH secretion     101104357 (HRAS)    04912 GnRH signaling pathway     101104357 (HRAS)    04915 Estrogen signaling pathway     101104357 (HRAS)    04917 Prolactin signaling pathway     101104357 (HRAS)    04921 Oxytocin signaling pathway     101104357 (HRAS)    04926 Relaxin signaling pathway     101104357 (HRAS)    04935 Growth hormone synthesis, secretion and action     101104357 (HRAS)    04919 Thyroid hormone signaling pathway     101104357 (HRAS)    04916 Melanogenesis     101104357 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     101104357 (HRAS)    04726 Serotonergic synapse     101104357 (HRAS)    04720 Long-term potentiation     101104357 (HRAS)    04730 Long-term depression     101104357 (HRAS)    04722 Neurotrophin signaling pathway     101104357 (HRAS)   09158 Development and regeneration    04360 Axon guidance     101104357 (HRAS)   09149 Aging    04211 Longevity regulating pathway     101104357 (HRAS)    04213 Longevity regulating pathway - multiple species     101104357 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     101104357 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101104357 (HRAS)    05206 MicroRNAs in cancer     101104357 (HRAS)    05205 Proteoglycans in cancer     101104357 (HRAS)    05203 Viral carcinogenesis     101104357 (HRAS)    05230 Central carbon metabolism in cancer     101104357 (HRAS)    05231 Choline metabolism in cancer     101104357 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101104357 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101104357 (HRAS)    05225 Hepatocellular carcinoma     101104357 (HRAS)    05226 Gastric cancer     101104357 (HRAS)    05214 Glioma     101104357 (HRAS)    05216 Thyroid cancer     101104357 (HRAS)    05221 Acute myeloid leukemia     101104357 (HRAS)    05220 Chronic myeloid leukemia     101104357 (HRAS)    05218 Melanoma     101104357 (HRAS)    05211 Renal cell carcinoma     101104357 (HRAS)    05219 Bladder cancer     101104357 (HRAS)    05215 Prostate cancer     101104357 (HRAS)    05213 Endometrial cancer     101104357 (HRAS)    05224 Breast cancer     101104357 (HRAS)    05223 Non-small cell lung cancer     101104357 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101104357 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     101104357 (HRAS)   09165 Substance dependence    05034 Alcoholism     101104357 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101104357 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101104357 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101104357 (HRAS)    05170 Human immunodeficiency virus 1 infection     101104357 (HRAS)    05161 Hepatitis B     101104357 (HRAS)    05160 Hepatitis C     101104357 (HRAS)    05163 Human cytomegalovirus infection     101104357 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101104357 (HRAS)    05165 Human papillomavirus infection     101104357 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101104357 (HRAS)    01522 Endocrine resistance     101104357 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     101104357 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101104357 (HRAS)    04031 GTP-binding proteins [BR:oas04031]     101104357 (HRAS) Membrane trafficking [BR:oas04131]  Endocytosis   Macropinocytosis    Ras GTPases     101104357 (HRAS) Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101104357 (HRAS)   Exosomal proteins of colorectal cancer cells    101104357 (HRAS) GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101104357 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin Ldh_1_N AAA_25 Motif Other DBs NCBI-GeneID:  101104357 NCBI-ProteinID:  XP_027815796 Ensembl:  ENSOARG00000007365 UniProt:  A0A6P7DAM5 LinkDB All DBs Position 21 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINHTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKMRKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgccggcggcgtggggaagagcgccctgacc atccagctcattcagaaccacttcgtggacgagtacgaccccaccatcgaggactcctac cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc gtgtttgccatcaaccacaccaagtccttcgaggacatccatcagtaccgggagcagatc aagagggtgaaggactcggacgacgtgcccatggtgttggtcgggaacaagtgcgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcattccg tacatcgagacctccgccaagacccgccagggcgtggaggacgccttctacactctggtg cgcgagatccggcagcacaagatgcgcaagctgagcccaccggacgaggggggccccggc tgcctgagctgcaggtgcctgctctcctga

Ovis aries (sheep): 114114919 Help Entry 114114919         CDS       T03117                                  Definition (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism oas  Ovis aries (sheep) Pathway oas01521   EGFR tyrosine kinase inhibitor resistance oas01522   Endocrine resistance oas04010   MAPK signaling pathway oas04012   ErbB signaling pathway oas04014   Ras signaling pathway oas04015   Rap1 signaling pathway oas04062   Chemokine signaling pathway oas04068   FoxO signaling pathway oas04071   Sphingolipid signaling pathway oas04072   Phospholipase D signaling pathway oas04137   Mitophagy - animal oas04140   Autophagy - animal oas04144   Endocytosis oas04150   mTOR signaling pathway oas04151   PI3K-Akt signaling pathway oas04210   Apoptosis oas04211   Longevity regulating pathway oas04213   Longevity regulating pathway - multiple species oas04218   Cellular senescence oas04360   Axon guidance oas04370   VEGF signaling pathway oas04371   Apelin signaling pathway oas04510   Focal adhesion oas04540   Gap junction oas04550   Signaling pathways regulating pluripotency of stem cells oas04625   C-type lectin receptor signaling pathway oas04630   JAK-STAT signaling pathway oas04650   Natural killer cell mediated cytotoxicity oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04664   Fc epsilon RI signaling pathway oas04714   Thermogenesis oas04720   Long-term potentiation oas04722   Neurotrophin signaling pathway oas04725   Cholinergic synapse oas04726   Serotonergic synapse oas04730   Long-term depression oas04810   Regulation of actin cytoskeleton oas04910   Insulin signaling pathway oas04912   GnRH signaling pathway oas04915   Estrogen signaling pathway oas04916   Melanogenesis oas04917   Prolactin signaling pathway oas04919   Thyroid hormone signaling pathway oas04921   Oxytocin signaling pathway oas04926   Relaxin signaling pathway oas04929   GnRH secretion oas04933   AGE-RAGE signaling pathway in diabetic complications oas04935   Growth hormone synthesis, secretion and action oas05010   Alzheimer disease oas05022   Pathways of neurodegeneration - multiple diseases oas05034   Alcoholism oas05132   Salmonella infection oas05160   Hepatitis C oas05161   Hepatitis B oas05163   Human cytomegalovirus infection oas05165   Human papillomavirus infection oas05166   Human T-cell leukemia virus 1 infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05170   Human immunodeficiency virus 1 infection oas05200   Pathways in cancer oas05203   Viral carcinogenesis oas05205   Proteoglycans in cancer oas05206   MicroRNAs in cancer oas05210   Colorectal cancer oas05211   Renal cell carcinoma oas05213   Endometrial cancer oas05214   Glioma oas05215   Prostate cancer oas05216   Thyroid cancer oas05218   Melanoma oas05219   Bladder cancer oas05220   Chronic myeloid leukemia oas05221   Acute myeloid leukemia oas05223   Non-small cell lung cancer oas05224   Breast cancer oas05225   Hepatocellular carcinoma oas05226   Gastric cancer oas05230   Central carbon metabolism in cancer oas05231   Choline metabolism in cancer oas05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114114919    04012 ErbB signaling pathway     114114919    04014 Ras signaling pathway     114114919    04015 Rap1 signaling pathway     114114919    04370 VEGF signaling pathway     114114919    04371 Apelin signaling pathway     114114919    04630 JAK-STAT signaling pathway     114114919    04068 FoxO signaling pathway     114114919    04072 Phospholipase D signaling pathway     114114919    04071 Sphingolipid signaling pathway     114114919    04151 PI3K-Akt signaling pathway     114114919    04150 mTOR signaling pathway     114114919  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114114919    04140 Autophagy - animal     114114919    04137 Mitophagy - animal     114114919   09143 Cell growth and death    04210 Apoptosis     114114919    04218 Cellular senescence     114114919   09144 Cellular community - eukaryotes    04510 Focal adhesion     114114919    04540 Gap junction     114114919    04550 Signaling pathways regulating pluripotency of stem cells     114114919   09142 Cell motility    04810 Regulation of actin cytoskeleton     114114919  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114114919    04650 Natural killer cell mediated cytotoxicity     114114919    04660 T cell receptor signaling pathway     114114919    04662 B cell receptor signaling pathway     114114919    04664 Fc epsilon RI signaling pathway     114114919    04062 Chemokine signaling pathway     114114919   09152 Endocrine system    04910 Insulin signaling pathway     114114919    04929 GnRH secretion     114114919    04912 GnRH signaling pathway     114114919    04915 Estrogen signaling pathway     114114919    04917 Prolactin signaling pathway     114114919    04921 Oxytocin signaling pathway     114114919    04926 Relaxin signaling pathway     114114919    04935 Growth hormone synthesis, secretion and action     114114919    04919 Thyroid hormone signaling pathway     114114919    04916 Melanogenesis     114114919   09156 Nervous system    04725 Cholinergic synapse     114114919    04726 Serotonergic synapse     114114919    04720 Long-term potentiation     114114919    04730 Long-term depression     114114919    04722 Neurotrophin signaling pathway     114114919   09158 Development and regeneration    04360 Axon guidance     114114919   09149 Aging    04211 Longevity regulating pathway     114114919    04213 Longevity regulating pathway - multiple species     114114919   09159 Environmental adaptation    04714 Thermogenesis     114114919  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114114919    05206 MicroRNAs in cancer     114114919    05205 Proteoglycans in cancer     114114919    05203 Viral carcinogenesis     114114919    05230 Central carbon metabolism in cancer     114114919    05231 Choline metabolism in cancer     114114919    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     114114919   09162 Cancer: specific types    05210 Colorectal cancer     114114919    05225 Hepatocellular carcinoma     114114919    05226 Gastric cancer     114114919    05214 Glioma     114114919    05216 Thyroid cancer     114114919    05221 Acute myeloid leukemia     114114919    05220 Chronic myeloid leukemia     114114919    05218 Melanoma     114114919    05211 Renal cell carcinoma     114114919    05219 Bladder cancer     114114919    05215 Prostate cancer     114114919    05213 Endometrial cancer     114114919    05224 Breast cancer     114114919    05223 Non-small cell lung cancer     114114919   09164 Neurodegenerative disease    05010 Alzheimer disease     114114919    05022 Pathways of neurodegeneration - multiple diseases     114114919   09165 Substance dependence    05034 Alcoholism     114114919   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     114114919   09171 Infectious disease: bacterial    05132 Salmonella infection     114114919   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     114114919    05170 Human immunodeficiency virus 1 infection     114114919    05161 Hepatitis B     114114919    05160 Hepatitis C     114114919    05163 Human cytomegalovirus infection     114114919    05167 Kaposi sarcoma-associated herpesvirus infection     114114919    05165 Human papillomavirus infection     114114919   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     114114919    01522 Endocrine resistance     114114919  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oas04131]     114114919   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     114114919    04031 GTP-binding proteins [BR:oas04031]     114114919 Membrane trafficking [BR:oas04131]  Endocytosis   Macropinocytosis    Ras GTPases     114114919 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    114114919   Exosomal proteins of colorectal cancer cells    114114919 GTP-binding proteins [BR:oas04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114114919 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  114114919 NCBI-ProteinID:  XP_027826364 UniProt:  A0A6P7E6Q6 LinkDB All DBs Position 5 AA seq 144 aa AA seqDB search MTGDKLVVVGAMVRKSALTIQLIENHPVDDNVPSYEGWLPLSSYWKQVVTDGETCLLDTA GQESQRHGDQYMSTREGFPLGACISDTESFKGIHQPWEQIKWVKASDGIPVVLVGTRQLL DLWLQLREPLEPTAIPVNQQPLKL NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgacgggggataagctcgtggtggtgggcgccatggtgaggaagagcgccctgaccatc cagctcatcgagaaccaccctgtggacgacaatgtcccctcctacgaaggctggctgcct ctaagctcctactggaagcaagtggtcactgatggggagacctgcctactggacacagca ggccaggagagtcagcgtcatggagaccagtacatgagcaccagggagggctttcccctg ggtgcttgcatcagcgatactgagtccttcaagggcatccaccagccctgggagcagatc aagtgggtgaaggcctcagatggcatacctgtggtgctggtgggaacaaggcagctgctc gacctctggctccagctaagggaacccctggaacccactgcgattcccgtgaaccagcag cccctcaagctgtga

DBGET integrated database retrieval system