KEGG   Ovis aries (sheep): 101104552Help
Entry
101104552         CDS       T03117                                 

Gene name
CACNA1F
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1F isoform X1
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04020  Calcium signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04260  Cardiac muscle contraction
oas04261  Adrenergic signaling in cardiomyocytes
oas04270  Vascular smooth muscle contraction
oas04723  Retrograde endocannabinoid signaling
oas04725  Cholinergic synapse
oas04726  Serotonergic synapse
oas04727  GABAergic synapse
oas04911  Insulin secretion
oas04912  GnRH signaling pathway
oas04921  Oxytocin signaling pathway
oas04924  Renin secretion
oas04925  Aldosterone synthesis and secretion
oas04927  Cortisol synthesis and secretion
oas04929  GnRH secretion
oas04934  Cushing syndrome
oas05010  Alzheimer disease
oas05410  Hypertrophic cardiomyopathy (HCM)
oas05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
oas05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101104552 (CACNA1F)
   04020 Calcium signaling pathway
    101104552 (CACNA1F)
   04024 cAMP signaling pathway
    101104552 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    101104552 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101104552 (CACNA1F)
   04929 GnRH secretion
    101104552 (CACNA1F)
   04912 GnRH signaling pathway
    101104552 (CACNA1F)
   04921 Oxytocin signaling pathway
    101104552 (CACNA1F)
   04924 Renin secretion
    101104552 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    101104552 (CACNA1F)
   04927 Cortisol synthesis and secretion
    101104552 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101104552 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    101104552 (CACNA1F)
   04270 Vascular smooth muscle contraction
    101104552 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    101104552 (CACNA1F)
   04725 Cholinergic synapse
    101104552 (CACNA1F)
   04726 Serotonergic synapse
    101104552 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    101104552 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101104552 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101104552 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101104552 (CACNA1F)
   05414 Dilated cardiomyopathy (DCM)
    101104552 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101104552 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101104552 (CACNA1F)
Ion channels [BR:oas04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101104552 (CACNA1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101104552
NCBI-ProteinID: XP_027818583
Ensembl: ENSOARG00000010594
LinkDB All DBs
Position
X
AA seq 1970 aa AA seqDB search
MSASEGGKDTTPEPSPANGTGPGPEWGLCPGPPASDGEISGASGLETPKRKTQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDTPHMGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDIEAEEDPSPCASSGSGRACTLNQTECR
GRWAGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWITQAEELDVEDPS
AAGNFGSVAEEGLGGHRPQLAELTNRRRGRLRWFSHSTHSTSSHASLPASDTGSMAETQG
DEEEEEGTLASCTRCLNKIMKTSVCRCLRRANRGLRARCRRAVKSNACYWAVLLLVFLNT
LTIASEHHGQPFWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSVYVSSFFNRFDCFVVCG
GILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLL
FLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDGIMA
YGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTDKDKGREKITEETPQ
ENGALVPGGENEEEESAKNEGAGMEEEEEEEEEEEEEGGAGHVELLQEVVPKEKVVPIPE
GSAFFCLSQTNPLRKACHTLIHHHIFTNLILVFIILSSVSLAAEDPIRAHSFRNHILGYF
DYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISVVKI
LRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFY
SCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEG
WPALLYKAIDANAEDKGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQE
YQDCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVAL
AMQHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFTDAWNTFDALIVVGSVV
DIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQAL
PYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQE
IMLASLPGSRCDPESDFGPGEEFSCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYL
TRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKR
LVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRMKQKLLD
EVIPPADEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGTEAPPSTSSALQAGLRSLQDL
GPEMRQALTCDTEEEEGEEGQEGEEEEHEGLETYTALMGSQPTSRRSSVISVSLPVGDKP
PDSLSPGPSDDDGGAPNSRQSNVPQSGSHAHRRSSGVLIFTIPEEGSSQTKATKGQEKQD
EQEEVLSQLSYLDEQAGTPPRPILLPSHRPQRYVDGHQAPRRRLLPPTPAGRKPSFTIQC
LRRQGSCEDLPIPGTYHRGRNSGPSRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGK
SSSPLRTFTCLHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIAD
ACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
NT seq 5913 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatctgaaggcgggaaagacaccaccccagagcccagtccagccaatgggaca
ggccctgggcccgaatgggggctgtgccctgggcccccagcatcagatggtgaaatcagc
ggggcatcgggcctagagacccctaagcgaaagactcagcacagtaagcacaagacagtg
gcagtagccagtgcccagcggtcaccccgggcactcttctgcctcaccctggcaaacccc
ctgcggcggtcctgcatcagcattgtggaatggaagcccttcgacatcctcatcttgctg
accatctttgccaattgcgtggccctgggagtctacatccccttcccagaggacgactcc
aacacggccaaccacaacctggagcaggtggaatacgtatttttggtgattttcactgtg
gagacggtgctcaagatcgtggcctacgggctggtgcttcaccccagcgcctacatccgc
aacggctggaacctgctcgacttcatcattgtcgtggtcgggctgttcagcgtgctgctg
gagcagggtcccggacgcccaggggacaccccgcatatgggagggaagccagggggcttc
gatgtgaaggcattgcgggcatttcgggtgctgcggccactgaggctggtgtctggggtc
ccaagcctgcacatagtgctcaattccatcatgaaggctctggtgccactgttgcatatc
gcacttcttgtgctctttgtcatcatcatttacgccatcatcggactggagctgttcctt
ggacgcatgcacaaaacatgctacttcctgggatctgacatagaggcagaggaggacccg
tcaccctgtgcgtcctcaggatcagggcgtgcttgcacgctgaaccagacggagtgccgt
gggcgctgggcagggcccaacggaggcatcaccaactttgacaactttttcttcgccatg
ctgacagtcttccagtgcatcaccatggaaggctggaccgacgtcctctactggatgcag
gatgccatggggtatgagctgccctgggtgtatttcgtgagtctcgtcatctttggatcc
ttcttcgtcctcaaccttgtacttggtgtcctgagtggggagttctccaaagagagggag
aaggcaaaagcacgaggggatttccagaagcttcgggagaagcagcagctggaggaggac
ctccggggctacctggactggatcacacaggcggaggagctggacgtggaggacccctca
gctgctggcaactttggttccgtggctgaagagggcctgggcggccaccggccacaactg
gcagagctgaccaataggagacgaggacgtctgcgctggttcagtcactccacccactcc
accagcagccacgccagcctcccagccagtgacaccggttcaatggcagagacccaagga
gacgaggaagaggaagagggcactctagccagctgtacacgctgcctaaataagatcatg
aaaaccagcgtttgccgctgtctccgccgagccaaccggggccttcgggcgcgctgccgg
agggctgtgaagtccaatgcctgctactgggccgtgttgctgcttgtcttcctcaacact
ctgacaatcgcctcggagcaccatgggcagcccttctggctcacccagatccaggagtat
gccaacaaagtgttgctctgtctattcacggtggagatgcttctcaagttgtatggtctg
gggccctctgtctacgtgtcctccttcttcaaccgctttgactgcttcgtggtctgtggg
ggcatcctggagactaccctggtggaggtgggtgccatgcagcccctgggcatctcggta
ctccgctgtgtgcgcctcctcaggatctttaaggtcaccaggcactgggcatctctgagc
aatttagtggcgtctctgctcaattcaatgaaatccattgcatccttgctgcttctcctc
ttcctctttatcatcatcttctccctgcttggcatgcagctgtttgggggcaagttcaac
tttgaccagacccacaccaagcgaagcacctttgacacctttccccaggccctcctcact
gtctttcagatactgacgggtgaggactggaatgtggtcatgtatgatggtatcatggcc
tatggcggccccttcttcccagggatgctggtgtgcgtgtatttcatcatcctcttcatc
tgcggcaattacatcctattgaatgtgtttcttgccatcgctgtggacaacctggccagt
ggagacgcaggcactgacaaagataagggcagggagaagatcactgaggaaactccacag
gagaatggagcactggtgcctggtggggagaatgaggaagaggaatctgcaaaaaatgaa
ggagcaggcatggaggaagaggaggaggaggaagaagaggaggaagaggaagggggggct
gggcatgtggagctcctgcaggaagttgtacccaaggagaaggtggtacccatccctgag
ggcagcgcttttttctgcctcagccaaaccaacccgctgaggaaggcctgccacaccctc
atccaccatcacatcttcaccaatctcatcctggtgtttatcatcctcagcagcgtgtcc
ctggccgctgaggatcccatccgagcccactccttccgcaaccacattctggggtacttc
gattatgccttcacctccattttcactgtggagattctactaaagatgacagtgtttggg
gctttcctgcaccgcggctccttctgccgtagctggttcaatctgctggatctgctagtg
gtcagcgtgtccctcatctcctttggtatccactccagcgccatctcagtggtgaagatt
ctgcgtgtgctccgagtactgcggccccttcgagccatcaacagggccaaaggactcaag
cacgtggtgcaatgtgtgttcgtggccatccggaccatcggaaatatcatgatcgtgacc
acgctcctgcagttcatgttcgcctgcattggtgtgcagctcttcaaggggaaattctac
agttgcactgatgaggccaaacacacaccccaagaatgcaagggctccttcctggtctac
cccgatggagatgtgtcaaggcctctggtccgggagcggctctgggtcaacagcgatttc
aactttgacaatgtcctttcagccatgatggccctgttcactgtctccaccttcgaaggc
tggcctgcgctgctatacaaggccattgatgcaaacgcagaggacaagggccccatctac
aattaccacgtggagatctcagtgttcttcattgtctacatcatcatcattgcattcttc
atgatgaacatctttgtgggctttgtcatcatcaccttccgagcccagggcgagcaggag
taccaagactgtgagctggataagaaccagcgccagtgtgtagaatacgccctcaaggcc
caaccactccgtcgctatatccccaagaacccacatcagtatcgtgtgtgggccactgtg
aactctgctgccttcgagtatctcatgttcctgctcatcctgctcaacacagttgctcta
gccatgcagcactatgagcagactgctcccttcaactatgccatggacatcctcaacatg
gtcttcactggcctcttcactgtcgagatggtgctcaaaatcattgccttcaaacccaag
cattactttactgatgcctggaacacatttgatgctcttattgtggtgggcagcgtagtg
gacattgccgtcactgaagtcaacaatggtggccacctgggcgagagctctgaggacagt
tcccgcatttcaatcaccttctttcgcctcttccgagtcatgcgattggtcaagcttctt
agtaagggtgaagggattcgcacgttactctggacattcatcaagtcttttcaggcctta
ccctatgtggctcttctcatcgcaatgatattcttcatttatgcagtcattgggatgcag
atgttcggcaaggtggctcttcaggatggcacacagatcaaccgaaacaacaacttccag
acctttccacaggctgtactgcttttgttcaggtgtgctactggtgaggcatggcaggag
ataatgcttgccagccttcccggaagccggtgtgaccctgagtctgacttcggccctggt
gaggagtttagctgtggtagcaattttgccatcgcctattttatcagcttcttcatgctc
tgtgcattcctgatcataaatctctttgtggctgtgatcatggacaactttgattatcta
accagagattggtccatcctgggcccccatcacctcgatgaattcaagaggatttggtct
gaatatgaccctggggccaaaggccgcatcaagcacctggatgtggttgccctgctgaga
cgcatccagccccccctgggattcgggaagctgtgcccgcaccgagtggcctgcaagaga
cttgtggcgatgaacatgcccctcaactcagatgggacagtgacattcaatgccacactc
tttgccctggtccggacatccctgaagatcaagacagaagggaacctggagcaagccaat
caggagctgcggattgtcatcaaaaagatctggaagcggatgaagcagaagctgctagat
gaggtcatcccgccagctgacgaggaagaagttaccgtgggcaaattctacgccacattt
ctgatccaggactattttcgcaaattccggcggaggaaagaaaaggggctactaggcacc
gaggcccccccaagcacctcctctgcccttcaggctggcctgaggagcctgcaagacttg
ggtccagagatgcggcaggccctcacttgtgacacagaggaagaggaaggggaagagggg
caggagggagaggaagaggaacacgagggcctggaaacatacacagccctaatgggctcc
cagcccacatctcgccggagctccgtgatttctgtgtctctgcctgttggagacaaacct
ccagattcactttcccctggacccagtgatgacgatgggggggctcccaactccagacag
tccaatgttccccagtctgggtcccatgcccacaggagaagctctggggttctcattttc
accattccagaagaaggaagttctcagaccaaggcaaccaaagggcaagagaagcaggat
gagcaagaggaagtcctgagccagctctcctacctagatgaacaggcagggactccccca
cgccccatccttttgccatctcacagaccccagagatatgtggatggtcaccaagcacca
cgccgccgtctgttgcccccaacacctgcaggtcggaagccatccttcaccatccagtgt
ctgcggcgccagggcagctgtgaagatttacccatcccaggcacctatcatcgtggacgc
aactcagggcccagtagggcgcagggttcctgggcaacccctcctcaacggggccgactc
ttatatgccccactgctattggtggaggagggtgcagcaggggagggatacctcggcaaa
tccagcagtccactgcgcaccttcacctgtctgcatgtgcctggaacccactcggacccc
agccatggcaaaaggggcagtgctgacagcctggtggaagctgtgctcatctctgagggc
ctgggcctctttgctcgagacccacgcttcgtggccctggccaagcaggagattgcagat
gcatgtcgcctgaccctggacgagatggacagtgctgccagtgacctgctggcacagggg
accagctcactgtatagtgacgaagagtccatcctctcccgttttgatgaggaggaccta
ggagatgagatggcctgtgtccatgccctctga

DBGET integrated database retrieval system