KEGG   Ovis aries (sheep): 101104560Help
Entry
101104560         CDS       T03117                                 

Gene name
PTAFR
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-activating factor receptor
  KO
K04279  platelet-activating factor receptor
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101104560 (PTAFR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101104560 (PTAFR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101104560 (PTAFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101104560 (PTAFR)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Others
   Platelet activating factor
    101104560 (PTAFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 NPIP
Motif
Other DBs
NCBI-GeneID: 101104560
NCBI-ProteinID: XP_027821226
Ensembl: ENSOARG00000019840
LinkDB All DBs
Position
2
AA seq 421 aa AA seqDB search
MQLGNIMFSTFGKHWFTEIYGSSKYWPFIMRYLKDREAWSIVVHGVAKNQTQLSHEKRTT
IIRNRQDPMTSHHFQPTEMEPNNSFFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFA
RLYPSKKFNEIKIFMVNLTMADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINT
YCSVAFLAVITYNRFQAVTRPIKTAQATTRKRGFLLSLIIWVSIVGAASYFFVLDSTNRE
PKKTGSGNITRCFEHYEKGSIPVLIIHIFLVFSFFLVFLIILCCNLVIIRTLLTQQVQMQ
RNAEVKRRALWMVCTVLAVFIICFVPHHLVQLPWTLAELGFQDTDFHQGINDAHQVTLCL
LSTNCVLDPIIYCFLTKKFRKHLTEKLYSMRESRKCSRATSETGTEVVVQLKDAPIKSLK
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttggaaacatcatgttttccacttttgggaaacattggttcactgagatatat
gggtcttccaagtattggcctttcattatgaggtatttgaaggacagagaagcctggagc
attgtggtccatggggttgccaagaatcagactcaactcagccatgaaaaaagaacgaca
attataaggaacaggcaggatcctatgaccagccaccacttccagcccacagagatggag
ccaaataattccttttttcgtgtggactccgagttccgatacaccctcttcccaattttt
tacagcatcgtctttgtgctgggggtcattgccaacagctacgtgctgtgggtctttgcc
cgcttgtacccttccaagaaattcaacgagataaagatcttcatggtgaacctcaccatg
gctgacctgctcttcctggtcaccctgcccctgtggatcgtctactactacaaccagggc
gactggattcttcccaaattcctgtgcaacctggctggctgcttcttcttcattaacacc
tactgctcagtggccttcctggccgtcatcacttacaaccgcttccaggcagtgacaagg
cccatcaagaccgctcaggctaccacccgcaagcgtggcttccttctgtccctgataatc
tgggtgtccattgtgggcgcagcatcctacttcttcgttctggactcgaccaacagggag
cccaaaaagaccggctcgggcaacatcacacgctgctttgaacattacgagaagggcagc
atcccagtcctcatcatccacatcttcctggtgttcagcttcttcctcgtcttcctcatc
atcctgtgctgcaacctggtcatcatccgcacgctgctcacgcagcaggtgcagatgcag
cgcaacgctgaggtcaagcgccgggcactctggatggtctgcaccgtcctggctgtgttc
atcatctgtttcgtgccccaccacctcgtgcagctgccctggaccctggccgagctgggc
ttccaggacactgacttccaccaggggattaacgatgcgcaccaggtcactctctgcctc
cttagtaccaactgcgtcttagaccccattatctactgtttcctcaccaagaagttccgc
aagcacctcaccgagaagctgtacagtatgcgcgagagccggaagtgctcccgggccacc
tcggagacgggcacggaagtggtcgtgcagctcaaagacgcccctatcaaatcgctcaaa
tattag

DBGET integrated database retrieval system