KEGG   Ovis aries (sheep): 101104894Help
Entry
101104894         CDS       T03117                                 

Gene name
HTR6
Definition
(RefSeq) 5-hydroxytryptamine receptor 6
  KO
K04162  5-hydroxytryptamine receptor 6
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101104894 (HTR6)
   04024 cAMP signaling pathway
    101104894 (HTR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101104894 (HTR6)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101104894 (HTR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101104894 (HTR6)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101104894 (HTR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 101104894
NCBI-ProteinID: XP_012012813
LinkDB All DBs
Position
2
AA seq 440 aa AA seqDB search
MVPEQGPANHSTPDWGSGPPRAPGGSGWVAAALCVVIALTAAANALLIALICAQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNVLYGRWVLARGLCLLWAAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPARALALVLGAWSLAALASFLPLLLGWHEPGRARASAPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYSRILLAARKQAVQVASLSTGAAGQALETLQVP
RTPRPGVESADSRRLASKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCGCISLG
LFDVLTWLGYCNSTMNPIIYPLFMRDFRRALGRLLPCPRGPREQQPGLASPSVRTSHSGA
RPGLSLQHVLPLPLPPDSDSDSGSGSGGFPGPRFTAQLLLPGEATRDPPPPARASTTVNF
FSIDRTEPELRPHLPGTPTN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtcccagagcaaggccccgccaatcacagcaccccggactggggctcggggccgccg
cgggcccccgggggcagcggctgggtggccgccgcgctgtgcgtggtcatcgcgctgacg
gcagcggccaacgcgctgctcatcgcgctcatctgcgcgcagcccgcgctgcgcaacacc
tccaactttttcctggtgtcgctcttcacgtcggacctgatggtggggctggtggtgatg
ccgccggccatgctgaacgtgctgtacggccgctgggtgctggcgcggggcctctgcctg
ctctgggccgccttcgacgtgatgtgctgcagcgcctccatcctcaacctctgcctgatc
agcctggaccgctacctgctcatcctctcgccgctgcgctacaagctgcgcatgacgccc
gcgcgcgccctggcgctggtcctcggcgcctggagcctggccgcgctcgcctctttcctg
cccctgctgctgggctggcacgagccgggccgcgcgcgggcatccgcgccgggtcagtgc
cgcttgctggccagcctgcccttcgtcctcgtggcgtcgggcctcaccttcttcctgccc
tcgggcgccatctgcttcacctacagcaggatcttgctggccgcccgcaagcaggccgtc
caggtggcgtccctctccaccggcgctgccggccaggccttggagacgctgcaggtgccc
aggaccccacgcccaggggtggagtcagctgacagccggcgtctagccagcaagcatagc
aggaaggccttgaaggccagcctgaccctgggcatcctgctgggcatgttctttgtgacc
tggctgcctttctttgtggccaacatagtccaggccgtgtgtggctgcatctccctgggg
ctctttgacgtcctcacgtggctgggctactgcaacagcaccatgaaccccatcatctac
cctctcttcatgcgggacttccggcgggccctgggcaggctcctgccgtgtccccgcggc
ccccgggagcagcagccgggcctcgcctcgccctccgtgcggacctctcacagcggcgcg
cggcccggcctgagcctgcagcacgtgctgcccctgcccctgccgccggactcggactcg
gactcgggctcgggctccgggggctttcctggcccgcggttcacggcccagctgctgctg
cctggcgaggccacccgggacccaccccctcctgccagggcctctactaccgtcaacttc
ttcagcatcgatcgcacggagcctgagctgcggccgcatctgcctgggacccccacgaac
tga

KEGG   Ovis aries (sheep): 101105852Help
Entry
101105852         CDS       T03117                                 

Gene name
HTR1A
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101105852 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101105852 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101105852 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    101105852 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101105852 (HTR1A)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101105852 (HTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 101105852
NCBI-ProteinID: XP_014956699
Ensembl: ENSOARG00000005323
UniProt: W5P5K8
LinkDB All DBs
Position
16
AA seq 422 aa AA seqDB search
MDVLSPGQGNNTTSSQGPFGTRGNATGISDVTFSYQVITSLVLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAITDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVDKKAANH
RLAASPAPQPRKSVSAESDSRDWRQGTENKVTGAPCANGAVRQGEEGAALEVIEVHRVGN
SKEHLPLPSEAGALPYVPASFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctcagccccgggcagggcaataacaccacgtcgtcccagggtcccttcggg
acacgcggcaacgctactggcatctccgacgtgaccttcagctatcaagtaatcacctcg
ctagtgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtagtggcggcc
atcgccctggagcgctccctgcagaacgtggcgaactatctcataggctcgctggccatc
accgacctcatggtgtcggtgctggtcctgccaatggccgcgttgtaccaggtgctcaac
aagtggactctgggacaggtcacctgtgacctgttcatcgccctcgacgtgctgtgctgc
acctcgtccattctgcacctgtgcgctatcgcgctggatagatactgggccatcaccgac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcacc
tggctcattggcttcctcatctccatcccgcccatgctgggctggcgcaccccggaagac
cgctcggacccggacgcgtgcactatcagcaaggaccacggctacactatttactccacc
ttcggcgctttctacatccctctgctgctcatgctggttctctacgggcgcatctttcga
gccgcgcgattccgcatccgcaagacagttaagaaggtggacaagaaagcagccaaccat
cgccttgcggcgtcgccggccccgcagcccagaaagagcgtgagtgctgagtcggatagc
agagactggaggcagggcactgagaacaaggtaacaggggctccgtgcgccaatggagcc
gtgaggcagggcgaagaaggcgccgccctggaagtgatcgaagtgcaccgggtgggcaac
tccaaagagcatcttccgctgcccagcgaagccggtgctctcccctacgtccccgcctcc
ttcgagaagaaaaatgagcgcaacgccgaggccaagcgcaagatggccctggcccgcgag
aggaagacggtgaagactctgggcatcatcatgggcaccttcatcctctgctggttgccc
ttcttcatcgtggccctagtcctgcccttctgcgaaagcagctgccacatgcctaccctg
ttgggggccataatcaactggctgggctactccaactctctgcttaaccctgtcatttac
gcctacttcaacaaggacttccaaaacgcgtttaagaagatcatcaagtgcaaattctgc
cgccgatga

KEGG   Ovis aries (sheep): 101106827Help
Entry
101106827         CDS       T03117                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B isoform X1
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04540  Gap junction
oas04726  Serotonergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101106827 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101106827 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101106827 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101106827 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101106827 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101106827 (HTR2B)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101106827 (HTR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 101106827
NCBI-ProteinID: XP_012003880
Ensembl: ENSOARG00000020689
UniProt: W5QHN7
LinkDB All DBs
Position
2
AA seq 538 aa AA seqDB search
MYVHFHFIELEILFLRKESTLALSVWHGYKALKKQMTSLATDHADQCPESDQIKEKQRMA
FSFRIFEQHTSPGHVLQSSFDHLISSNWSGLQTESIPEKMKQTGEEQGNKPRWAALLILT
VIIPTIGGNILVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATWPL
PLVLCPAWLFLDVLFSTASILHLCAISVDRYIAIKKPIQANQYNSRATALIKIIVVWLIS
IGIALPVPIKGIETDVANPNNITCGLTKDRFGSFMLFGSLASFFTPLAIMIVTYFLTIHA
LQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGFHKDKTLPNARADILMR
RMSTVGKKSVQTISNEERASKVLGIVFFLFLLMWCPFFITNVTLVLCDSCNQMTLNMLLE
IFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYLTCNYRAPTSVKTLGKCSSNIYFRNPMAE
NSIFFMKHGMRNGINPAMYQSPMRLRGSTIQSSSIILLDTLLLTENEGDKTEEQISYV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtacactttcattttatagaacttgaaattctctttttaaggaaggagtcaact
ttggccttgagtgtttggcatgggtacaaagccttaaaaaagcagatgaccagcttagct
actgaccatgctgatcagtgtccggaatcagatcaaatcaaagaaaaacagcgaatggct
ttctcttttagaatattcgagcaacacacaagtcctgggcatgttttgcagagctcattt
gaccacttaatctcttctaactggtctggattacagacagaatcgataccagagaaaatg
aaacagactggtgaggaacagggaaataagccgcgctgggcagctcttctgatactcacg
gtgataatacccacaattggtggcaacatccttgttattctggctgtttcactggagaaa
aagttgcagtatgctaccaattatttcctaatgtccctggcagtggccgacttgctggtt
ggattgtttgtgatgccgattgccctcttaacaataatgtttgaggctacgtggcccctg
ccacttgttctatgccctgcctggttatttcttgatgttcttttttctactgcatccatc
ctgcatctctgcgccatttcagtggatcgttacatagccatcaaaaagccaatccaggcc
aatcaatataactcacgagctacagcattaatcaagattatcgtggtgtggttgatttca
ataggcattgcccttccagttcctattaaagggatagaaactgatgtggctaacccaaac
aacatcacctgtgggctgacaaaggatcgttttggcagtttcatgctctttggctcattg
gcttccttcttcacacccctggccatcatgattgtcacctactttctcactatccatgct
ttacagaagaaagcttacttggtcaaaaacaagccacctcaacgcctaacatggttgacc
gtgtccacagttttccaaagggatgaaacaccgtgctcatcaccagaaaaagtagcaatg
ctggatggctttcacaaggacaaaactctgcccaatgcaagagctgacatacttatgcga
agaatgtccacagtaggaaagaagtcagtgcagaccatttccaatgaagagagagcctca
aaggtcctcgggattgtatttttcctctttttacttatgtggtgccccttttttattaca
aatgtaactttagttttatgtgactcgtgcaaccagatgactctcaacatgctcctggag
atatttgtgtggataggctatgtttcctcaggggtgaatcctctggtctacactctcttc
aacaagacattccgggatgcatttggccggtacctcacctgcaattaccgagcccccaca
tcagtaaaaacccttggaaaatgctccagtaatatctactttcggaatccaatggcagag
aattctatattttttatgaaacatggaatgcgaaatggcattaatcctgccatgtaccag
agcccaatgaggctccgaggctcaaccattcagtcttcatccatcattttactagataca
cttctcctcaccgaaaatgaaggtgacaaaactgaagagcaaatcagttatgtatag

KEGG   Ovis aries (sheep): 101108550Help
Entry
101108550         CDS       T03117                                 

Gene name
HTR2C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04540  Gap junction
oas04726  Serotonergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101108550 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101108550 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101108550 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101108550 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101108550 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101108550 (HTR2C)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101108550 (HTR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF1385 Pox_P21 UPF0182
Motif
Other DBs
NCBI-GeneID: 101108550
NCBI-ProteinID: XP_014960567
Ensembl: ENSOARG00000017383
LinkDB All DBs
Position
X
AA seq 457 aa AA seqDB search
MVNVRKAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIILTIGGNILVIMAVSLEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISLGVSVPIPVIGLRDEDKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIHV
LRRQALMLLHGHTEEPPGINLNFLKCCKTNTDEENSANPNQDLNPRRRKKKERRPRGTMQ
AINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCS
GINPLVYTLFNKVYRRAFSNYLRCNYKADKKPPIRQIPRVAATALSGRELNVNIYRHTNE
PVIKKADDKEPGIEMQVENLELPVNPSNVISERISSV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatgtgaggaaagcagtgcactcattccttgtgcacctgattggcctattggtt
tggcaatgtgatatatctgtgagcccagtagcagccatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatt
gtcataataataatcttgacaataggtggcaacatcctcgttatcatggcagtaagcttg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgccactgtctctgcttgcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttctacagcg
tccatcatgcacctctgcgctatttcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcacggactaaggccatcatgaagattgctattgtttgggca
atttctttaggtgtatcagttcctatcccagtgattggactgagggatgaagacaaggtg
ttcgtcaacaacaccacctgcgtgctgaatgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacaatcatggtgattacctactgtctgacgattcacgtc
cttcgccgccaagctctgatgttactgcacggccacactgaggaaccgcctggaataaac
ctgaatttcctgaaatgctgcaagacgaacaccgatgaagagaattctgcaaacccgaac
caagatttgaacccacgccgaaggaagaagaaagaaagacggcctaggggcaccatgcaa
gctatcaacaatgaacggaaagcctcgaaggttcttggaattgtgttctttgtgtttctg
atcatgtggtgcccattttttattactaatattttgtcggttctttgtgggaaggcttgt
aatcaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgttca
ggaattaatcctctggtgtacacgcttttcaacaaagtttaccgaagggctttctccaac
tatttgcgctgcaattataaggcagataaaaagcctccaatcagacaaatcccgagagtt
gctgccactgctttgtctgggagggagcttaatgttaacatttaccggcacaccaatgaa
ccagtaattaagaaagctgatgacaaggagcctggtatagagatgcaagttgagaatttg
gagctaccggttaatccctccaatgtgattagtgaaaggattagtagtgtgtaa

KEGG   Ovis aries (sheep): 101111375Help
Entry
101111375         CDS       T03117                                 

Gene name
HTR1B
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101111375 (HTR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101111375 (HTR1B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101111375 (HTR1B)
  09157 Sensory system
   04742 Taste transduction
    101111375 (HTR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101111375 (HTR1B)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101111375 (HTR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 101111375
NCBI-ProteinID: XP_014952785
Ensembl: ENSOARG00000019953
LinkDB All DBs
Position
8
AA seq 403 aa AA seqDB search
MPQGCAPAPRARRVMEAAAPQCPQPPSASSQTGLSQANLSAGPSHNCSAAEEYIYQDFIA
LPWKVVVVLLLALFTLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPI
STMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKR
AAVMIALVWVFSICISLPPFFWRQAKAEAMSNCVVNTDHVLYTVYSTVGAFYFPTLLLIA
LYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRAPEVPSESGSPVY
VNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVIPICTSCWFH
QAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIGFKCTN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccccagggctgcgctccggcgccacgggcgaggagagtcatggaggcagcggcccct
cagtgtccccagccgccgtccgcgagttcccagactgggctttctcaagccaacctttcg
gctggtccctcccacaactgcagcgccgccgaggagtacatttaccaggacttcatcgcc
ctgccctggaaagtagtcgtggtcctgctgctggcgctcttcaccttggccaccacgctc
tccaacgcctttgtgatcgccactgtgtaccggacgcggaagctgcataccccggccaac
tacctgatcgcctccttggcggtcaccgacctgctcgtgtccatcctggtgatgcccatc
agtaccatgtacacggtcaccggccgctggacgctgggccaggtggtctgcgacttctgg
ctgtcgtcggacatcacctgttgcacagcctccatcctgcacctctgtgtcatcgccctg
gaccgctactgggccattacggacgccgtggagtactcggcgaaaaggactcccaagagg
gccgcggtcatgatcgcgctggtgtgggtcttctccatctgcatctcgctgccgcccttc
ttctggcggcaggccaaagctgaggcgatgtcgaactgtgtggtgaacaccgaccacgtc
ctgtacaccgtctactccacggtgggcgctttctacttccccaccctgctcctcatcgcc
ctctatggccgcatctacgtggaagcccgctcccggattttgaaacagacgcccaacaga
accggtaagcgtctgacccgagcccagctgattaccgactcccccgggtccacgtcttcg
gtcacctcgattaactcgcgggctccggaggtacccagcgaatccgggtctcctgtgtac
gtgaaccaagtcaaagtgcgcgtctccgacgccctgctggagaagaagaaactcatggcc
gctagggagcgcaaagccaccaagaccctggggatcattttgggcgcgttcatcgtgtgt
tggctgcccttcttcatcatctccctggtcatcccgatctgcacatcctgctggttccac
caggccatttttgacttcttcacgtggctgggctatctcaactccctcatcaaccccatc
atctacaccatgtccaacgaggacttcaaacaagctttccataaactcataggcttcaag
tgcacgaactga

KEGG   Ovis aries (sheep): 101114783Help
Entry
101114783         CDS       T03117                                 

Gene name
HTR1E
Definition
(RefSeq) 5-hydroxytryptamine receptor 1E
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101114783 (HTR1E)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101114783 (HTR1E)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101114783 (HTR1E)
  09157 Sensory system
   04742 Taste transduction
    101114783 (HTR1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101114783 (HTR1E)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101114783 (HTR1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 101114783
NCBI-ProteinID: XP_027828519
Ensembl: ENSOARG00000020007
LinkDB All DBs
Position
8
AA seq 365 aa AA seqDB search
MNITNCTPEASVAVRPKTITEKMLVSMTLAMITTLTMLLNSAVIVAICTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIMYIVMESWKLGYFICEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFGSCKLTQ
TFCVSDFSTSDPTTEFEKIHTSIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSTYAVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcactaactgtaccccggaagccagtgtggctgtgagacccaagaccatcacg
gagaagatgctcgtttccatgactctggcgatgatcaccaccctgactatgctgctaaac
tccgccgtgatcgtggccatctgcaccaccaagaagctccaccagcctgccaactacctg
atctgctctctagccgtgacggatctcctggtggccgtgcttgtcatgcccttgagcatc
atgtacatcgtcatggagagctggaagctggggtacttcatctgcgaggtgtggctgagt
gtggatatgacctgctgcacctgctccatccttcatctctgtgtgatcgccctggacagg
tactgggccatcaccaatgctatcgagtatgccaggaagaggaccgccaagagggccggg
ctgatgatcctcacagtctggaccatctccatcttcatctccatgccccctctgttctgg
aggagccaccgccaactcagcccaccccctagtcagtgcaccatccagcacgaccacgtc
atctacaccatctactccacgctcggggcattctacattcccttgactctgatactgatt
ctgtattaccggatttaccatgcagccaagagcctttaccagaaaagaggttcaagccgg
catttaagcaacagaagcactgacagccaaaattcgttcggcagttgtaaactgacacag
acgttctgtgtgtctgacttctccacctcagaccctaccacagagtttgagaagatccac
acctccattaggattcctccctttgacaatgacctagatcacccaggagaacgccaacaa
atctccagcaccagggagcgcaaggcagcacgaatcctgggtctgattttgggtgcgttc
atcttgtcgtggctgccattcttcatcaaagaattgatagtaggtctgagcacctatgct
gtgtcctccgaagtggctgattttttgacctggcttggttatgtgaattctctgatcaac
cctctgctctacacaagtttcaatgaagactttaagctggcttttaaaaagcttattcgg
tgccgagaacatacttag

KEGG   Ovis aries (sheep): 101116905Help
Entry
101116905         CDS       T03117                                 

Gene name
HTR5A
Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 5A
  KO
K04161  5-hydroxytryptamine receptor 5
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101116905 (HTR5A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101116905 (HTR5A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101116905 (HTR5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101116905 (HTR5A)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101116905 (HTR5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 101116905
NCBI-ProteinID: XP_027824941
LinkDB All DBs
Position
4
AA seq 358 aa AA seqDB search
MDPPANLSYFTLSTPAPGETNRSLSTQQTRAPACPLLSVFGVLVLTLLGFLVAATFAWNL
LVLATILRVRTFHRVPHNLMASMAISDVLVAALVMPLSLVHELSGRRWQLGQRLCQLWIA
CDVLCCTASIWNVTAIALDRYWSITRHLEYTLRARRRVSNVMIALTWALSAVISLAPLLF
GWGETYSEGSEECQVSREPSYXVFSTEGAFYLLLGVVFFVYWKIYKAAKLRVGPRKTNSV
SPISETVQVGDSAGQKQWVLATRRATVPFQADRDAWGEQKEQRAALMVGILIGVFALCWI
PFFTAELLSPLRACDSPATWKSAFLWLGYSNSFLNPXIYMAFNKNYNSAFKNLFSRHR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacccacctgcgaacctcagctacttcaccctctccacccccgcccctggggagacc
aaccgcagcctttcgacgcagcagacccgcgccccagcctgccccctgctctctgtcttc
ggggtgcttgtcctgaccttgctgggcttcctggtggcggccacgttcgcctggaacctg
ctggtgctggcgaccattctccgcgtgcgcacattccaccgcgttccacacaacttgatg
gcatctatggccatctcggacgtgctggtagccgctctggtcatgccgctgagcctggtg
cacgagctgtccgggcgccgctggcagctgggccagcggctgtgccagctgtggatcgcg
tgcgatgtgctctgctgcacggccagcatctggaacgtgacggccatcgcgctggaccgc
tactggtccatcacccgtcacctggaatacacgctgcgcgcccgcaggcgcgtctccaac
gtcatgatcgcgctcacctgggcgctctccgccgtcatctccttggccccgctgctcttc
ggctggggcgagacctactcggagggcagcgaggagtgccaggtgagccgcgagccctcc
tacnacgtgttctccaccgagggcgccttctacctgctgctcggcgtggtgttctttgtg
tactggaagatctacaaggccgccaagctccgagtgggcccccggaagaccaacagcgtc
tcacccatatccgaaaccgtgcaggtgggtgacagcgctgggcagaagcaatgggtcctc
gccacgcgccgcgccacggtccccttccaggccgacagggacgcgtggggcgagcagaag
gagcagcgcgccgccctcatggtgggcatcctcatcggggtgttcgcgctctgctggatc
ccgttcttcaccgccgagctcctcagccccctgcgcgcctgcgacagcccggccacctgg
aagagcgccttcctgtggctcggctactccaactccttcttgaatcccnccatctacatg
gccttcaacaagaactacaacagcgccttcaagaacctcttctcgaggcaccgctga

KEGG   Ovis aries (sheep): 101117482Help
Entry
101117482         CDS       T03117                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 5B
  KO
K04161  5-hydroxytryptamine receptor 5
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101117482
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101117482
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101117482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101117482
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101117482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4 OppC_N
Motif
Other DBs
NCBI-GeneID: 101117482
NCBI-ProteinID: XP_027819769
LinkDB All DBs
Position
2
AA seq 369 aa AA seqDB search
MEAANLSVASTGVALRLGPEAFSSSPNPSGVVGSTPGGAAPPGREPPFSVFSVLVVTLLV
LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAALVMPLSLVSELSXGRRW
LLGRSLCHVWISFDVMCCTASIWNVAAIALDRYWTITRHLQYTLRTRRRASMLMIALTWA
LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYLPLGVVLFVYWKIYKAA
KFRFGRRCRAVLPLPSTVQVKEAPQEAEMVFTARRPMVAFQTSGASWREQKEKRAAVMVG
ILIGVFVLCWIPFFLAELIGPLCACSLPPIWKSVFLWLGYSNSFFNPLIYTAFNKNYNNA
FKNLFTRQR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctaacctctcggtggcctccaccggcgtcgcccttcgcctgggacccgaa
gccttcagcagtagcccaaacccaagcggggtcgtcggatcgaccccaggtggtgcggcc
ccgccgggccgagaaccgcctttctccgtcttctcggtgctggtagtgacgctgctggtg
ctgctgatagcggccacgttcctgtggaacctgctggttctggtcaccatcctgcgggtc
cgcgcctttcaccgtgtgccgcataacttggtggcctcgacggccgtgtcggacgtgcta
gtggcagcgctggtaatgcccctgagcctggtgagcgagctgtcgngcgggcgacggtgg
ctgctgggccggagtctatgccacgtgtggatctccttcgacgtgatgtgctgcaccgcc
agcatttggaacgtggcggccatcgccctggaccgctactggactatcacgcgccacctg
cagtacacgctgcgcacccgccgccgcgcctcgatgctcatgatcgcgctcacctgggcg
ctctcggctctcatcgccctcgcaccactgctcttcggctggggcgaggcgtacgacgct
cgactccagcgctgccaggtgagccaggaaccctcctacgcagtcttctccacctgcggc
gccttctacctgccgcttggcgtggtgctgtttgtctattggaagatatataaggcggcc
aagtttcgcttcggtcgccgctgcagggctgtgctgcccttgccctccactgtgcaggta
aaggaggcccctcaggaggctgagatggtgttcacggctcgccgccccatggtggccttt
cagacgagcggagcctcatggcgggagcagaaggagaagcgggcagcagtgatggtgggc
atcctcatcggcgtgttcgtgctgtgctggatccccttcttcctggctgagctcatcggc
cccctctgtgcctgcagcctgccccccatctggaaaagcgtgttcctgtggcttggctac
tccaactctttcttcaatcccctgatttacacagcatttaataagaactacaacaatgcc
ttcaagaaccttttcaccaggcagagataa

KEGG   Ovis aries (sheep): 101117928Help
Entry
101117928         CDS       T03117                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101117928 (HTR4)
   04024 cAMP signaling pathway
    101117928 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101117928 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101117928 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101117928 (HTR4)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101117928 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 101117928
NCBI-ProteinID: XP_027826431
Ensembl: ENSOARG00000004789
LinkDB All DBs
Position
5
AA seq 438 aa AA seqDB search
MSCVLDAVSQIHFSEVFGREEYGDADAMGKPFSGFERQWRIWFLAGEFCSVLRVCVSSSA
KEGFKSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVS
VLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYR
NKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKVNQNSNSTYCIFMVNK
PYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGAPTEGRLQPTDQHSTHR
MRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFVDYTVPGQVWTAFLWLGYINSGLNPF
LYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWES
QSHPPASSPLVAAQPSDT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgtgtcctggatgctgttagtcaaatccacttcagtgaagtatttggaagagaa
gaatatggggatgcagatgccatgggaaaaccattttctggctttgagaggcagtggagg
atctggtttttggcgggagagttttgttcagttcttcgtgtttgtgtgtcttccagtgcc
aaggagggtttcaagtcagtggagaaggtcgtgctgctcacgtttctctcggcagttatc
ctgatggctatcttggggaacctactggtgatggtggctgtgtgcagggacaggcagctc
aggaaaataaaaaccaattatttcattgtgtctcttgcctttgcggatctgctggtgtca
gtgctggtgatgcccttcggtgccattgagctggttcaagacatctggatttacggggag
atgttctgccttgtccggacatctctggatgtcctgctcacaacagcatcgatttttcac
ctgtgctgcatttctctggataggtattatgccatctgctgccagcctttggtctatagg
aacaagatgacccctctgcgaatcgcattaatgctgggaggctgctgggtcatccccacg
tttatctcttttctccctataatgcaaggctggaataacattggaataattgatttgata
gaaaaaaggaaggtcaatcagaactctaactctacgtactgtatcttcatggtcaacaag
ccctacgccatcacctgctccgtggtagccttctacatcccatttctcctcatggtgctg
gcctattatcgcatctatgtcacagctaaggagcatgctcaccagatccagatgctgcaa
cgggcaggagcccccacagagggcagactccaaccaacagaccagcatagcactcatcgc
atgaggacagagaccaaagcagccaagactctgtgcatcatcatgggttgcttctgcctt
tgctgggctccattctttgtcaccaatattgtggatccattcgtagactatactgttccc
gggcaggtgtggaccgctttcctctggcttggctacatcaattctggattgaaccccttt
ctctacgccttcttgaataagtcttttagacgtgccttcctcatcatcctctgctgtgat
gatgaacgctaccgaagaccttccattttgggccagactgtcccctgttcaaccacaact
attaatggatccacacatgtgctaagggatgcagtggaatgtggtggccaatgggagagt
cagtcccaccccccagcaagttctcctctggtggccgcacagcccagtgacacttag

KEGG   Ovis aries (sheep): 101121647Help
Entry
101121647         CDS       T03117                                 

Gene name
HTR1F
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101121647 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101121647 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101121647 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    101121647 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101121647 (HTR1F)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101121647 (HTR1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 101121647
NCBI-ProteinID: XP_014947888
Ensembl: ENSOARG00000001305
UniProt: W5NT63
LinkDB All DBs
Position
1
AA seq 366 aa AA seqDB search
MDFLNSSDQNLTSEELLNRMPSKILVSFILSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISIFISMPPLFWRHQGTSQEDECIIKHDHIV
STIYSTFGAFYIPLTLILILYYKIYKAAKTLYHKRQASRIAKEEMNGQVLLESGEKSSRL
VSTPYMLAKSLSDPSTDFDKIHSTVKSPRSEFKHERSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCEKCKISEEMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttgaattcatctgatcaaaacttgacctcagaagaactgttaaacagaatg
ccatccaaaattctggtgtccttcattctctctggactggcactgatgacaaccaccatt
aactcacttgtgattgctgcaattattgttacccgaaagctgcaccacccagccaactac
ttaatttgctcccttgcagtcacagatttccttgtagccgttctggtgatgcctttcagc
attgtgtatattgtgagagagagctggattatgggacaagtggtctgtgacatctggctg
agcgttgacattacatgctgtacatgttccatcttgcatctctctgctatagctttggat
cggtaccgggcaatcactgatgctgttgagtatgccaggaaaaggactcccaagcatgct
ggcattatgatcaccatagtttggattatatctatttttatctctatgcctcctctattc
tggaggcaccaaggaactagtcaagaggatgagtgcatcatcaaacacgaccacatcgtt
tccacgatttactcaacatttggagctttctacattccattaacattgattttgatcctc
tattacaaaatatataaggcagcaaagacgttatatcacaagaggcaagcaagtaggatt
gccaaggaggaaatgaatggccaagtccttttggagagtggtgaaaaaagctctagactg
gtctccacaccgtacatgctagcaaagtctttatctgatccatcaacggactttgataaa
attcatagcacagtgaaaagtcccaggtctgaattcaagcatgagagatcttggagaagg
caaaagatctcaggcacaagagaacgcaaagcagccactaccctgggattaattttgggt
gcatttgtaatatgttggcttcctttctttgtaaaagaattggttgttaatgtctgtgaa
aagtgtaagatttctgaagaaatgtcaaattttttgacatggcttggatatctcaattcc
cttataaacccactgatttatacaatctttaatgaagacttcaagaaagcattccaaaaa
cttgtgcgatgtcgatgttag

KEGG   Ovis aries (sheep): 101122172Help
Entry
101122172         CDS       T03117                                 

Gene name
HTR1D
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101122172 (HTR1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101122172 (HTR1D)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101122172 (HTR1D)
  09157 Sensory system
   04742 Taste transduction
    101122172 (HTR1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101122172 (HTR1D)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101122172 (HTR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx CPP1-like
Motif
Other DBs
NCBI-GeneID: 101122172
NCBI-ProteinID: XP_014949175
Ensembl: ENSOARG00000018425
UniProt: W5QAN1
LinkDB All DBs
Position
2
AA seq 377 aa AA seqDB search
MSPPNQSGEGLLQGAPNRSLNATETPGAWDPGTLQALKIALAVVLSIVTLATVLSNAFVL
TTIFLTRKLRSPANCLVGSLAVTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDVT
CCTASILHLCVIALDRYWAITDALEYSKRRTVRHAAAMIAMVWAISVCISIPPLFWRQAK
THEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYMAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNPSLQQGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKAT
KTLGIILGAFIVCWLPFFVASLVLPICRDSCWIPPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKVVRFRKTS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccccaaaccagtcaggagaaggtcttctgcagggggctcccaacagatccctg
aatgccacagaaactccaggcgcttgggacccagggacgctccaggccctcaagattgct
ctggccgtggtcctttccatcgtcaccctggccacagtcctttccaatgcctttgtgctc
accaccatcttcctgaccaggaagctccgcagcccagccaactgcctcgttggctccctg
gcggtgacggacctgttggtgtctatcttggtcatgcccatcagcatcgcctacaccacc
acccacacctggagcttcggccaactcctgtgtgacatctggctgtcttctgacgtcaca
tgctgcacggcctccatcctgcacctctgtgtcattgctctggacaggtactgggccatc
acggatgcgctggagtacagtaaacgccggactgtgcgccacgcggccgccatgatcgcc
atggtctgggccatctcggtctgcatctccatcccacccctcttttggcggcaggccaaa
actcacgaagagatgtcggactgcctggtgaacacgtctcagatctcctacaccatctac
tccacctgtggggccttctacatcccgtccgtgttgctcatcatcctctacggccgtatc
tacatggccgcccggaaccgcatcctgaatccgccgtccctctacgggaagcgcttcacc
accgcgcatctcatcacaggctctgcagggtcctcgctgtgctcgctcaaccccagcctt
cagcaggggcattctcattcagccggctcccctctcttttttaaccacgtgaaaatcaag
cttgccgatagtgtcctggaacgcaagaggatttctgctgcccgggagaggaaagccaca
aaaaccctgggcatcattctgggggcctttatcgtctgctggctgcccttctttgtagca
tctctggtccttcccatctgcagagactcctgctggatccccccagcactttttgacttt
ttcacctggctaggctatcttaactccctcatcaatccaataatctatactgtgtttaac
gaagagtttcggcaagcgtttcagaaagttgtccgtttcaggaaaacctcttag

KEGG   Ovis aries (sheep): 101122994Help
Entry
101122994         CDS       T03117                                 

Gene name
HTR7
Definition
(RefSeq) 5-hydroxytryptamine receptor 7
  KO
K04163  5-hydroxytryptamine receptor 7
Organism
oas  Ovis aries (sheep)
Pathway
oas04014  Ras signaling pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101122994 (HTR7)
   04020 Calcium signaling pathway
    101122994 (HTR7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101122994 (HTR7)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101122994 (HTR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101122994 (HTR7)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101122994 (HTR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 101122994
NCBI-ProteinID: XP_004020077
LinkDB All DBs
Position
22
AA seq 435 aa AA seqDB search
MMDVNSSGRPDLYGHLRSFFLPEVGRGLPDLSPDGAGPVAGSWAPHLLHGVVEVTASPGP
IRDAPRDNTSGCWEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNY
LIVSLALADLSVAVAVMPFVSVTDLIGGEWIFGRFFCNVFIAMDVMCCTASIMTLCVISI
DRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDGKVCLISQDFG
YTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRPEEPDSVISLNGMVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGIA
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERPELVP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaatagcagcggccgcccggacctctacgggcacctccgctctttcttc
ctgccggaggtggggcgcgggctgcccgacctgagccccgacggcgccggcccggtcgcg
ggctcctgggcgccgcacctgctgcacggggtcgtggaggtgacggctagccccgggccc
atccgggacgcgccgcgggacaatacctccggctgttgggagcagatcaactacggccga
gccgagaaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgccggc
aactgcctggtggtgatttcggtgtgcttcgtcaaaaagctccggcagccctccaactac
ctgatcgtgtccctggcgctggccgacctttcggtggccgtggcggtcatgcccttcgtc
agcgtcaccgaccttattgggggcgagtggatctttggccgtttcttctgtaacgtcttt
atcgccatggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagcatc
gacaggtaccttggtatcacgaggccgctgacttaccctgtgaggcagaacgggaagtgc
atggccaagatgatcctctccgtctggcttctgtccgcctccatcactttaccgccgctc
tttggctgggctcagaacgtcaatgacggcaaggtgtgcttgatcagccaggactttggc
tacacgatttactccactgcagtggcattttatatccccatgtccgtcatgcttttcatg
tactaccagatttacaaagccgccaggaagagcgccgccaaacacaagttccctggcttc
ccccggccagaggagcccgacagcgtcatctccctcaatggcatggtgaagctccagaag
gaggtagaggagtgtgcaaacctttcgaggctcctcaaacacgaaaggaaaaacatctcc
atctttaagagggagcagaaagcagccaccaccctgggcatcatcgtcggggccttcacc
gtgtgctggctgccatttttcctcctctcgactgccaggcccttcatctgcggcatcgcc
tgcagctgcatcccgctgtgggtggagaggacatgtctgtggctgggctatgcaaactct
ctcatcaacccctttatatatgccttcttcaaccgggacctgaggaccacctaccgcagc
ctgctccagtgccagtaccggaacatcaaccggaaactctcggcagcaggcatgcacgag
gccctgaagctcgccgagaggccggagaggcctgagctcgtgccgtaa

KEGG   Ovis aries (sheep): 114109037Help
Entry
114109037         CDS       T03117                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 1D-like
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04726  Serotonergic synapse
oas04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    114109037
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114109037
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    114109037
  09157 Sensory system
   04742 Taste transduction
    114109037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    114109037
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    114109037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF3278
Motif
Other DBs
NCBI-GeneID: 114109037
NCBI-ProteinID: XP_027813035
LinkDB All DBs
Position
18
AA seq 198 aa AA seqDB search
MTDPLVSILGMFISITHTTAHTWSCVTSGHLLTSHAAKPPSWYWAITDTLENSKHQTVGH
VAAMLAIIWAIFIHISIPSLLWQQAKAHEEISACLVNTSLISYIIYSICGALYIPPVLLI
ILYGQIYTNTWNHILTPLLLYGKYFTNISSKTARSLLCSFKASLHEGHSYLISSPLIFNH
VKIKLVDSVLEHKRISAA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccccttagtttctattttgggcatgttcatcagcatcacacatacaactgcc
cacacctggagttgtgtgacatctggtcatcttctgacatcacatgctgcaaagcctcca
tcctggtactgggccatcactgataccctggagaacagtaaacaccagacagtgggccat
gtggctgccatgcttgccatcatctgggccattttcatccacatctccatcccatcactc
ttgtggcagcaggctaaagctcatgaagaaatatcagcttgcctggtgaatacttcactg
atctcttacattatctattccatttgtggggccctctacatcccgcctgtattgctcatt
atcctctatggacaaatctacacaaacacctggaaccacatcctgactccattattactt
tatgggaagtacttcaccaacatctcatcaaagactgcgaggtccttgctctgctcgttc
aaagccagccttcatgaggggcactcttatttgatcagttcccctcttattttcaaccat
gtgaaaatcaagcttgtggatagtgttctggagcacaagaggatttctgctgcttga

KEGG   Ovis aries (sheep): 443018Help
Entry
443018            CDS       T03117                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
oas  Ovis aries (sheep)
Pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04540  Gap junction
oas04726  Serotonergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    443018 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443018 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    443018 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    443018 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    443018 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    443018 (HTR2A)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    443018 (HTR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 443018
NCBI-ProteinID: XP_004012115
Ensembl: ENSOARG00000008133
LinkDB All DBs
Position
10
AA seq 470 aa AA seqDB search
MDILCEENTSLSSTTNSLMQLHADTRLYNTDFNSGEGNTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADENFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRTKLASFSFLPQSSLSSEKLFQRSIH
REPCAHGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNRDVIEAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQMGPKKNSKKDGKTTDNDCTMVALGKGHSEDAPADSSNTVNEKVSCV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggatattctctgtgaagaaaacacttctttgagctcaactacgaactccttaatgcaa
ttacatgctgacacaaggctctacaatactgactttaactccggagaaggtaacacttcg
gatgcatttaactggaccgtggactcggaaaatcgaaccaacctttcctgtgagggctgt
ctctcaccaccctgcttctccttacttcatctccaggaaaagaactggtctgctctgttg
acagcggtagtgattatactaaccattgccggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcactcgccatagctgat
atgctgctgggtttcctggtcatgcccgtgtccatgttaaccatcctctatgggtaccgg
tggcctctgcccagcaagctctgcgctgtttggatttacctggatgtgctcttctccacg
gcctccatcatgcatctctgtgccatttccctggaccgctatgttgccattcagaacccc
atccatcacagccggttcaactccagaactaaggcgtttctgaaaataattgctgtttgg
acgatatcagtgggtatatccatgccaatcccagtctttgggctccaggacgattccaaa
gtctttaaggaagggagttgcttactggcggatgagaactttgtcctgattggctctttc
gtggcctttttcattcccttaaccatcatggtgatcacctactttctcaccatcaagtcg
ctccagaaagaagccactttgtgtgtgagtgatcctggaacacggaccaaattagcttct
ttcagcttcctgcctcagagctccctgtcttcggagaagctcttccagcggtccatccac
agggagccatgcgcccacggccggagaactatgcagtccatcagcaacgagcagaaggct
tgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccccttcttcatc
accaacataatggctgtcatctgcaaagagtcctgcaacagggatgtcatcgaagccctg
ctcaacgtgttcgtttggatcggttacctctcctcagcagtcaacccactggtgtataca
ctgttcaataagacctataggtcggccttttccaggtatattcagtgtcagtacaaggaa
aataaaaaaccattgcagttaattttagtgaacactatcccagccttggcctacaagtcc
agtcaactccaaatgggaccgaaaaagaattcgaagaaagatggcaagacgacagataat
gactgcactatggttgctctaggaaaagggcattctgaagatgctcctgcagacagtagc
aacacagtgaacgaaaaggttagctgtgtctga

DBGET integrated database retrieval system