KEGG   Ovis aries (sheep): 101105430Help
Entry
101105430         CDS       T03117                                 

Gene name
PDYN
Definition
(RefSeq) proenkephalin-B precursor
  KO
K15840  proenkephalin B (prodynorphin)
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101105430 (PDYN)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    101105430 (PDYN)
   05031 Amphetamine addiction
    101105430 (PDYN)
   05034 Alcoholism
    101105430 (PDYN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oas02000]
    101105430 (PDYN)
Transporters [BR:oas02000]
 Other Transporters
  Pores ion channels [TC:1]
   101105430 (PDYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Opiods_neuropep
Motif
Other DBs
NCBI-GeneID: 101105430
NCBI-ProteinID: NP_001267606
Ensembl: ENSOARG00000007354
UniProt: L7PA78
LinkDB All DBs
Position
13
AA seq 258 aa AA seqDB search
MAWQGLVLAACLLALPSVTADCLAQCSLCAVKTQDGPQPINPLVCSLECQAALQPAQEWE
RCQGLLSFLTPFTVGLNGKEDLKSKAVLEESSSEPAKHIRPYLKELEKNRFLLSTPAEEN
TLSSSLAEKLRGLSGRLGEDAEYELMGDAQLNDGALEAEARDSNEEEPKEQVKRYGGFLR
KYPKRSSEVTGKGAGEGEGGEMGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKV
VTRSQEDPSAYYEELFDV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcaagggctggtcctggctgcttgtctgctcgcactcccctccgtcacagcg
gactgcctggcccagtgctccttgtgtgctgtgaagacccaggatgggccccaacccatc
aaccccctggtttgctccctggaatgccaggccgccctgcagcctgctcaggagtgggag
aggtgccagggccttctgtctttcctcactcccttcaccgttgggctcaatggcaaggaa
gacttgaagagcaaggcagttttggaagagtctagcagtgagccggccaagcacatcagg
ccctacttgaaggaactagagaaaaacagattccttctcagcaccccagcagaggagaac
actctgagcagcagcctggcggagaagctcaggggtctctctggcaggttgggggaggat
gcagagtatgagttgatgggggatgctcagctgaacgatggtgccctggaggctgaagcg
agggattccaatgaggaggaacccaaggagcaggtcaaacgttatgggggctttttgcgc
aaataccccaagaggagctcagaggtgactgggaagggggctggggaaggggaggggggt
gagatgggccatgaggacctgtacaagcgctacgggggattcttacggcgcatccgtccc
aagctcaagtgggacaaccagaagcgctatggtggcttcctccggcgtcagttcaaggtg
gtcactcggtctcaggaagaccccagtgcctattacgaagagctttttgatgtgtaa

KEGG   Ovis aries (sheep): 101109024Help
Entry
101109024         CDS       T03117                                 

Gene name
PENK
Definition
(RefSeq) proenkephalin-A
  KO
K18832  proenkephalin A
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101109024 (PENK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oas02000]
    101109024 (PENK)
Transporters [BR:oas02000]
 Other Transporters
  Pores ion channels [TC:1]
   101109024 (PENK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Opiods_neuropep
Motif
Other DBs
NCBI-GeneID: 101109024
NCBI-ProteinID: XP_027828772
LinkDB All DBs
Position
9
AA seq 263 aa AA seqDB search
MARFLGLCTWLLALGPGLLATVRAECSQDCATCSYRLARPTDLNPLACTLECEGKLPSLK
TWETCKELLQLTKLELPPDATSALSKQEESHLLAKKYGGFMKRYGGFMKKMDELYPLEAE
EEANGGEVLGKRYGGFMKKDAEEDDGLGNSSNLLKELLGAGDQREGSLHQEGSDAEDVSK
RYGGFMRGLKRSPHLEDETKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEPLPSE
EEGESYSKEVPEMEKRYGGFMRF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggttcctgggactctgcacttggctgcttgcgctcggccccgggctcctggcg
accgtgagggcagaatgcagccaggactgcgccacgtgcagctaccgcctggcgcgcccg
accgacctcaacccgctggcttgcactctggaatgtgaggggaaactgccttctctcaag
acctgggaaacctgcaaggagcttctgcagctgaccaaactagagcttcctccggatgcc
accagtgccctcagcaaacaggaggagagccacctgcttgccaagaagtacgggggcttc
atgaagcggtatgggggcttcatgaagaaaatggatgagctgtaccccctggaagcggag
gaagaggcaaatggaggtgaggtccttggcaagagatatgggggcttcatgaagaaggat
gcagaggaagatgatggcctgggcaactcctccaacctgctcaaggagctgctgggagct
ggggaccagcgagaggggagcctccaccaggagggcagtgatgctgaagatgtgagcaag
agatacggcggcttcatgagaggcttaaagagaagcccccacctggaagatgaaaccaaa
gagctgcagaagcgatacgggggtttcatgagaagagtgggtcgtccggagtggtggatg
gactaccagaaaaggtacggtggcttcctcaagcgctttgccgagcccctaccctccgag
gaagaaggcgaaagttactccaaggaagttcctgaaatggagaaaagatacggaggattt
atgagattttaa

KEGG   Ovis aries (sheep): 443212Help
Entry
443212            CDS       T03117                                 

Gene name
POMC
Definition
(RefSeq) pro-opiomelanocortin precursor
  KO
K05228  proopiomelanocortin
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04920  Adipocytokine signaling pathway
oas04925  Aldosterone synthesis and secretion
oas04927  Cortisol synthesis and secretion
oas04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443212 (POMC)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443212 (POMC)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    443212 (POMC)
   04915 Estrogen signaling pathway
    443212 (POMC)
   04916 Melanogenesis
    443212 (POMC)
   04925 Aldosterone synthesis and secretion
    443212 (POMC)
   04927 Cortisol synthesis and secretion
    443212 (POMC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    443212 (POMC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACTH_domain NPP Op_neuropeptide
Motif
Other DBs
NCBI-GeneID: 443212
NCBI-ProteinID: NP_001009266
UniProt: P01191
LinkDB All DBs
Position
3
AA seq 263 aa AA seqDB search
MPRLCSSRSGALLLVLLLQASMEVRGWCLESSQCQDLTTESNLLACIRACKPDLSAETPV
FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNGSSSFGAGGAAQKREEEVAVGEGPGPRGD
GAETGPREDKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEFKRELTGERLE
QARXPEAQAESAAARAELEYGLVAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSE
KSQTPLVTLFKNAIIKNAHKKGQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgccgagactgtgcagcagtcgttcgggcgccctgctgctggtcttgctgcttcaggcc
tccatggaagtgcgtggttggtgcctggagagcagccagtgtcaggacctcaccacggaa
agtaacctgctggcgtgcatccgggcctgcaagcccgacctctcggccgagacgccggtg
ttccccggcaacggcgatgagcagccgctgactgagaacccccggaagtacgtcatgggc
catttccgctgggaccgcttcggccgtcggaatggtagcagcagcttcggagctgggggc
gcggcccagaagcgcgaggaggaagtggcggtgggcgaaggccccgggccccgcggcgat
ggcgccgagacgggtccgcgagaggacaagcgttcttactccatggaacacttccgctgg
ggcaagccggtgggcaagaagcggcgcccggtgaaggtgtaccccaacggcgccgaggac
gagtcggcccaggcctttcccctcgaattcaagagggagctgaccggggagaggctcgag
caggcgcgcngccccgaggcccaggctgagagcgcggccgcccgggctgagctggagtat
ggtctggtggcagaggctgaggcggccgagaagaaggactcggggccctataagatggaa
cacttccgctggggcagcccgcccaaggacaagcgctacggcgggttcatgacctcggag
aagagccaaacgccccttgtcacgctgttcaaaaacgccatcatcaagaacgcccacaag
aagggccagtga

DBGET integrated database retrieval system