KEGG   Ovis aries (sheep): 101105597
Entry
101105597         CDS       T03117                                 

Gene name
CUL5
Definition
(RefSeq) cullin-5
  KO
K10612  cullin 5
Organism
oas  Ovis aries (sheep)
Pathway
oas04120  Ubiquitin mediated proteolysis
oas05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101105597 (CUL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101105597 (CUL5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:oas04121]
    101105597 (CUL5)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101105597 (CUL5)
Ubiquitin system [BR:oas04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Cullin
     101105597 (CUL5)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101105597 (CUL5)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 101105597
NCBI-ProteinID: XP_004016047
Ensembl: ENSOARG00000010875
UniProt: W5PMI8
LinkDB
Position
15
AA seq 780 aa
MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAK
IHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMG
KQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGV
RESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKE
EEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLM
DKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQ
DDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWL
REVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSS
EKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQL
AVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDF
TEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAII
QIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggcgacgtctaatctgttaaagaataaaggttctcttcagtttgaagacaaatgggat
ttcatgcgtccaattgttctgaagcttttacgccaggaatctgttacaaaacagcagtgg
tttgatctgttttcggatgtacatgcagtctgtctctgggatgataaaggcccagcaaaa
attcatcaggctttaaaagaagatattcttgagtttattaagcaagcacaggcacgagta
ctgagccatcaagatgatacagctttgctaaaagcttacattgttgaatggcgaaaattt
tttacacagtgtgatattttaccgaagcctttctgtcaactagagattactttaatgggt
aaacagggcagcaataaaaaatcaaatgtagaagacagtattgttcgaaagcttatgctt
gatacatggaatgaatcaatcttttcaaatataaaaaacagacttcaagatagtgcaatg
aagctggtccatgctgaaaggttaggagaagcttttgattctcagcttgtcattggagta
agagaatcctatgttaacctttgttctaatccagaggataagctccaaatttatagggac
aattttgagaaggcatacttggattcaacagagagattttatagaacacaggcaccctcg
tatttacaacaaaatggtgtacagaattatatgaaatatgcagatgctaaattgaaagaa
gaagaaaaacgagccctacgttatttagaaacaagacgagaatgtaactctgttgaagca
ctcatggaatgctgtgtaaatgccctggtgacatcctttaaagagactatcttagcagag
tgccaaggcatgatcaagcgaaacgaaactgaaaaattacatttaatgttttcattgatg
gacaaagttcctaatgggatagaaccaatgttaaaagacttggaggagcatatcatcagt
gcgggcctggcagatatggtagcagctgctgaaactattactactgactctgagaagtat
gttgagcagttacttacactatttaatagattcagtaaacttgtcaaagaagcttttcaa
gatgacccacgatttcttactgcaagagacaaggcatataaagcagttgttaatgatgct
accatatttaaacttgaattacctttgaagcagaagggggtgggattaaaaactcagcct
gaatcaaaatgccctgagctgcttgccaattactgtgacatgttgctaagaaaaacgcca
ttaagcaaaaagctaacctctgaagagattgaagcaaagcttaaagaagtgctcttggta
cttaaatatgtacaaaacaaagatgtttttatgagatatcacaaagctcatttgacacga
cgtcttatattagacatctctgctgatagtgaaattgaagagaatatggtagagtggcta
agagaagttggtatgccagcagattatgtaaacaagcttgctagaatgtttcaggacata
aaagtatctgaagatttgaaccaagcttttaaggaaatgcacaaaaacaataaattggca
ttaccagctgattcagttaatataaaaattctgaatgctggtgcctggtcaagaagctct
gaaaaagtctttgtctcacttcctactgaactggaggatttgatacctgaagtagaagaa
ttctacaaaaagaaccatagtggaagaaaattacattggcatcatctcatgtcaaatgga
attataacatttaagaatgaagtaggccaatatgatttggaggtaacaacgtttcagctg
gctgtattgtttgcatggaaccaaagacccagagagaaaatcagctttgaaaatctaaaa
cttgcaactgaactccctgatgctgagcttaggaggactctatggtctttagtagctttc
ccaaagctcaaacggcaagttttattgtatgaacctcaagtcaactcacccaaagacttt
acagaaggtaccctcttttcagtgaaccaggagttcagtttaataaaaaatgcaaaagtt
cagaaaaggggtaaaatcaacttgattggacgcttgcagctcactacagaaagaatgaga
gaggaagagaatgaaggaatagttcaactaagaatactgagaacccaggaagctatcata
caaataatgaagatgagaaagaaaattagtaatgctcagctgcagactgaattagtagaa
attttgaaaaacatgttcctgccacaaaagaaaatgattaaagagcaaatagaatggcta
atagagcacaaatacatcagaagagatgaatctgatatcaacactttcatatatatggcg
taa

DBGET integrated database retrieval system