KEGG   Ovis aries (sheep): 101105847Help
Entry
101105847         CDS       T03117                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03440  Homologous recombination
oas04064  NF-kappa B signaling pathway
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04210  Apoptosis
oas04218  Cellular senescence
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05170  Human immunodeficiency virus 1 infection
oas05202  Transcriptional misregulation in cancer
oas05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    101105847 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101105847 (ATM)
   04068 FoxO signaling pathway
    101105847 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101105847 (ATM)
   04210 Apoptosis
    101105847 (ATM)
   04115 p53 signaling pathway
    101105847 (ATM)
   04218 Cellular senescence
    101105847 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101105847 (ATM)
   05206 MicroRNAs in cancer
    101105847 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101105847 (ATM)
   05170 Human immunodeficiency virus 1 infection
    101105847 (ATM)
   05165 Human papillomavirus infection
    101105847 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101105847 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101105847 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101105847 (ATM)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101105847 (ATM)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101105847 (ATM)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101105847 (ATM)
DNA replication proteins [BR:oas03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101105847 (ATM)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    101105847 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC Uso1_p115_head
Motif
Other DBs
NCBI-GeneID: 101105847
NCBI-ProteinID: XP_014956385
Ensembl: ENSOARG00000011894
LinkDB All DBs
Position
15
AA seq 3061 aa AA seqDB search
MSLALNDLLICCRQLELDRATERKREIEKFKRLIKDPETVRHLDQHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRTARQNVSASTQASRQKKMQEISSLVKGFIKCANKRAPRLKCQEL
LNYIIYTVKDSSSGAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYCSLYLKPSQ
DINRVLVARIIQVVTKGCCSQTDGLNLKFLDFFCKAIHQARQETSSAGLNHILAAFIIFL
KTLSVNFRIRVCELGDEILPTLLYIWTQQRLNNSLKEVIIELFQLQIYIHHPKGAKTQDK
GAYESRKWRSILYNLYDLLVNEISHIGSRGKYTSGSRNIAVKENLIELMADICHQVFNED
SRSLEISQSYTTTQKELTDYSVPCKKRKIELGWEVIKDHLQKSQNDFEIVPWLQIATQLI
SKYPASLPNCELSPLLMILYQLLPQQRHGERTPYVLRCLMEVALCQGKRSNLESSLKSDL
LKIWIKIWSITFRGISSEQIQTENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLTLALTICVVPESVKIGIEKNICDVSRNSLKELIMKWLLFCQLEDDFEDSTELPPILCS
NFPHLTLEKILVSLTMKNCKAAMNFFQSVPECEQHQKDTEEPSFSEAEDLFLQTTFDKMD
FLTIVKEHTIEKHQSSVGFSVHQNLKESLDRYLLRLSEQLLSNYSSETSNSEMFVRCSSL
LVGVLGCYCYLGVLAEEEAYKSELFQKAKSLMQCAGESITLFKNKTSEEPRIVSLRNMIH
LCTSCLHNCSKHSPNKIASGFFLRLLTSKLMNDIADICKSLAFIIKKPFDFGEVESLEED
SDENQMRMEDQSYASLFNDSPASSVTDANESGKSQITIGAMNPLAEEHLSKQDLLSLDIL
KFLCMCVTTAQTNIVSFRAADIRRELLMLIDSSMLDPTRSLHLHMYLVLLKALPGEEYPL
PMEDVAKLLKPLPNVCSSYHRDQDVCKTILNHVLHVVMNLCHRNMDDENTRDAQGQFLTV
IGAFWHLTKEGKSTFSVRMALVNCLKTLLEADPYSKWSILNVKGKDLPVNEVFPQFLADN
HHQVRMLAAESINRLFQHIKRGSSTLKALPLKLQQTAFENAYFKAQEGMRELSHRTENSE
SLDEICNRKATLLMMIAVVLHCSPVCEKQALFALCKSVKENGLEPHLVKKVLKKVSETFG
YRCLEDFMASHLDYLVLEWLNLQDPEYSISSFPFILLNYTNIEDFYRSCYKILIPPLVIR
SHFDEVKLIANQIQEDWKSLLTDSFPKILVNILPYFAYEGTEDSGMAQQRETATKVYDTL
KDESLLGKQIDHLFISNLPEIVVELLMTLHEPATSGASQSTDPCDFSGDLDPAPNPPHFP
SHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKRHRIIKIY
HLFVSLLMNDIKSGLGGAWAFVLRDVIYTLIHYINQRPSHFMDVSLRTFSLCCDLLSRVC
HTAVTYCKDALESHLHVIVGTLIPLVDDQMEVQEQVLDLLKFLVIDNKDNENLYMTIKLL
DPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSAYDALPLTRLEGLKDLRRQLE
QHKDQMMDLMRASQDNPQDGIMVKLVVSLLQLSKMAVNHTGEREVLEAVGSCLGEVGPID
FSTIAIQHSKDTSYNKALELFEDKELQWTFVVLTYLNNTLVEDCVKVRAAAVTCLKSILT
TKTGHSFWDIYKATTDPMLIYLQPFRTSRKKFLEVPSLDKESPLEGLDDTSLWIPQSENH
DIWLKTLTCAFLNSGGTKSEVLQLLKPMCEVKTDFCQTVLPYLIHDILLQDTDESWRNLL
STHIQGFFTSCFKHSSQTSRSTTPANLDSESEHFFRCHVDKKSQRTMLAVVDYMRRQKRP
SSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKNLDDQEKRDALVTNRSL
TFEEGSQNTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRT
YEHEAMWGKALVTYDLETTISSSTRQAGIIQALQNLGLCHILSIYLRGLDHENKEWCAEL
QELHYQVAWRNMQWDHCISVNKEMERTSYHELLYNALQSLRDREFSTFYESLKHARVKEV
EELCKGSLESVYSLYPTLSRLQAIGELENIGELFSRSVTDRQPSEVYMKWWKHSQLLKDS
DFSFQEPIMALRTVILEILMEKEMENSQRECLKDILTKHLVELSVLARTFKNTQLPERAI
FQIKQYNSASSGVSEWQLEEAQVFWAKKEQSLALNILKQMIKKLDASCTENDPNLKLIYT
ECLRVCGTWLAETCLENPAVIMQTYLEKAVEVAENYDGESNDGLRNGKMKAFLSLARFSD
TQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRAL
KEDRKRFLCKAVENYINCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYK
FLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFLTKP
EAARRSRITKNAPKQSSQLDEDRTEAANKIIRTIRSRRPQMVRSVEALCDAYIILANLDA
TQWRTQRKGINIPADQPIIKLKNLEDVVVPTMEIKVDPTGEYGNLVTIKSFKEQFRLAGG
LNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTY
KVVPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPKDFSAIHCQKKMMDMQKKSFEE
KYETFMEICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQN
ILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTM
EVMRNSKETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPDDESELHSTPNADDQECKRNL
SDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAW
V
NT seq 9186 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactagaactcgatagagct
acagagcgaaagagagagattgagaaatttaagcgcctgattaaggatcctgaaactgtt
cgacatttagatcagcattcagattccaaacaagggaaatatttgaattgggatgctgtt
tttaggtttttacagaaatatattcagaaagaaacagaatgtctgagaacagcaagacaa
aatgtatcagcctcgacccaagccagtaggcagaaaaagatgcaagaaatcagtagcttg
gtcaagggcttcatcaaatgtgcaaataaaagagcacccaggctgaaatgtcaagaactg
ttgaattatatcatatatacagtgaaagattcatccagtggtgctatttatggagctgat
tgtagcaatatattgctgaaggacattctttcagtgaggaaatactggtgtgaaatatct
cagcaacagtggctcgaattgttctctgtgtattgtagtctatatcttaaaccttcacaa
gacattaatagagtgttggtggcaagaataattcaagttgtgaccaaaggatgctgttca
cagaccgatggattaaatctcaaatttttggattttttttgtaaggctattcaccaggca
cgacaagaaacgagctctgcaggtctaaatcatatcttagcagcatttattatcttcctc
aagactttgtctgttaactttcgaattcgagtgtgtgaattaggagatgaaattcttcct
accttactttatatttggactcaacagagacttaataattccttaaaagaagtaattatt
gaattatttcagctacaaatttatatccatcatccaaagggagccaaaactcaagataaa
ggtgcttacgaatcaagaaagtggagaagtattttatacaacctgtatgatttgctagtt
aatgaaataagtcatataggaagcagaggaaaatatacttcaggatctcgtaatattgct
gttaaggaaaacttgattgaattgatggcagatatttgtcaccaggtttttaatgaagat
tctagatctttggagatttctcagtcttacacaaccacacaaaaagaacttactgattac
agtgtaccttgcaaaaagaggaagatagaattaggctgggaagtaataaaagatcacctt
cagaagtcacagaatgattttgaaattgtaccttggttacaaatcgcaactcaattaata
tcaaaatatcctgcaagtttacctaactgtgagttgtcaccattactaatgatactatac
cagcttctacctcaacagcgacatggggaacgcacaccatatgtgttacgatgtcttatg
gaagttgcattgtgtcaaggcaagaggtcaaacctagaaagctcactgaagtcagattta
ttgaaaatctggattaaaatttggtctattacttttcgtggtataagttctgaacaaata
caaacagaaaactttggcttacttggagccataattcaaggcagtttagttgaggttgac
agagaattctggaagttatttactgggtcagcctgtagaccttcatgtcctgcagtatgc
tgtttgactttggcactgacaatctgtgtagttccagaatcagtaaaaataggaattgag
aaaaatatatgtgatgtaagcagaaattctttaaaggaattgataatgaaatggctctta
ttctgtcagttagaggatgactttgaagacagtacagaactacctccaattctttgcagt
aattttcctcatcttaccctggagaaaattctcgtgagtctcactatgaaaaattgtaaa
gcagcgatgaattttttccaaagtgtgccagaatgtgagcaacaccaaaaagatacagaa
gaaccttcattctcagaagctgaagatctgtttcttcagacaacttttgacaagatggat
tttttaaccattgtgaaagaacatacaatagagaagcaccaatccagtgtaggcttttct
gtccaccaaaacctcaaggagtcactggatcgctatcttttgagactatcagaacagctt
ctaagtaactactcatctgagacttcaaattcagagatgtttgtccggtgttcaagtctt
ttggtgggtgttcttggctgctattgttacctgggtgtcttagctgaagaggaagcatac
aaatcagaattattccagaaagccaagtctctaatgcagtgtgctggagaaagtatcact
ttgtttaaaaataagacaagtgaagaacctagaattgtttcattgagaaatatgatacat
ctatgtacaagttgcttacataactgttccaagcacagtccaaataagattgcatctggc
ttcttcttacgattattaacatcaaagctaatgaatgacattgcagatatttgtaaaagt
ttagcattcattatcaaaaagccttttgactttggagaagtagaatcactggaagaagat
tctgatgaaaatcaaatgaggatggaggatcagtcatacgcgagtctatttaatgattcc
cctgctagtagtgttactgatgcaaatgaatctggaaagagccaaattactattggtgcc
atgaatcctttagctgaagaacatctatcaaagcaagatctactttctttagacatactc
aagttcttgtgtatgtgtgtaaccactgctcagactaacattgtgtcatttagggcagct
gatattcgaagggaattattaatgttaattgattctagcatgctagatcctacgagatct
cttcatttacacatgtatctagtgcttttaaaggcgcttcctggagaagaatatcccttg
ccaatggaagatgttgcaaaacttctaaaaccactacccaatgtgtgttcatcttatcac
cgtgaccaagatgtttgtaaaaccattttaaaccatgtccttcacgtagtgatgaaccta
tgtcacagaaatatggatgatgagaacacaagggatgctcaaggacagtttctaacagtg
attggagcattttggcacttaacaaaggaggggaaaagtacattctctgtaagaatggca
ctagtaaactgccttaaaactttgcttgaggctgatccttattcaaaatggtctattctg
aatgtaaagggaaaagatcttcctgtaaatgaagtatttccacagtttcttgctgataat
catcaccaagttcgcatgttggctgcggagtcaatcaatagattgtttcagcatataaaa
cgaggttcttccacattgaaagcacttcctttgaaacttcagcaaacagcttttgaaaat
gcatactttaaagctcaggaaggaatgagagaattgtcccacagaactgaaaactctgaa
agtttggatgagatttgtaatagaaaagccactttactgatgatgatagctgtggtgtta
cactgcagccctgtctgtgaaaagcaggctttattcgccctatgcaagtctgtgaaagag
aatggactagagcctcaccttgttaaaaaggttttaaagaaagtttctgagacttttgga
tatagatgtttagaagatttcatggcttctcatttggattacttggtattggaatggcta
aatcttcaagatcctgaatacagtatatcttcttttccttttattttattaaattacaca
aacattgaagatttctataggtcttgttataaaattttgattccacctctagtgattaga
agtcattttgatgaagtaaagttaattgctaatcaaattcaagaggattggaaaagtctt
ctgacagactcctttccaaagattcttgtaaatattcttccatactttgcttatgagggt
acagaagacagtgggatggcacagcaaagagagactgctaccaaagtctatgatacgctt
aaagatgaaagcttattaggaaaacagattgatcatttattcattagtaatttaccagag
attgtagtggagttattgatgacgttacatgaaccagcaacttctggtgccagccaaagc
actgacccctgtgacttctcaggggatttggatcctgctcctaatccacctcattttcca
tcacatgtgattaaagcgacatttgcctatatcagcaattgccataaaaccaagcttaaa
agcattttagaaattctttccaaaagccctgattcctatcagaaaattcttctagccata
tgtgagcaagcagctgagacaaataatgtttacaaaaggcacagaattattaaaatatat
cacctgtttgttagtttattaatgaacgatataaagagtggcttaggaggagcttgggcc
tttgttcttcgagatgttatttatactttgattcactatatcaaccaaaggccttctcat
ttcatggatgtgtcattacgtaccttctccctttgttgtgacctattaagccgggtttgc
cacacagcggtaacttactgtaaggatgctttagaaagtcatcttcatgttattgttggt
acacttataccccttgtggatgatcagatggaagttcaggaacaggtgttggacttgttg
aaattcttagtgattgataacaaggataatgaaaatctgtatatgacaattaaactttta
gatccttttcctgaccatgttgtctttaaggatttgcgtattactcagcagaaaatcaaa
tacagtagaggacccttttcacttttggaggaaatcaaccattttctctcagtaagtgct
tatgatgcacttccattaacaaggcttgaaggattgaaggatcttcgaagacaactagag
caacataaagatcagatgatggatcttatgagagcatctcaggataaccctcaggatggc
ataatggtgaagctagttgtcagcttgttgcagttatccaagatggcagtaaaccacact
ggtgaaagagaagttttagaggctgttggaagctgcttgggagaagtgggtcctatagat
ttctctacaatagctatacaacatagtaaagatacatcttataacaaggctcttgagtta
tttgaagataaagaacttcagtggaccttcgtagtgctgacttacctgaataatactctg
gtagaagattgtgtcaaagtgcgagcggcagctgttacctgtttgaaaagcattttaacc
acaaaaactggacatagtttctgggatatttataaggcaacaactgatcccatgctgatc
tatctacagccttttagaacatcaagaaaaaagtttttagaagtaccaagtcttgacaaa
gaaagtcctttagaaggcttggatgatacaagcctgtggattcctcaaagtgaaaatcat
gacatttggttaaagacactgacttgtgcttttttgaatagtggtggcacaaaaagtgaa
gtccttcagttattaaagccaatgtgtgaggtgaaaactgacttttgtcagactgtgctt
ccatatttgattcatgatattctactacaagatacagatgaatcatggagaaatctcctt
tctacacacattcagggatttttcactagctgtttcaaacactcttcacaaacaagccga
tctacaacccctgcaaatttggattcagagtcagagcacttttttcgatgccatgtggat
aaaaaatcacaaagaacgatgcttgctgttgtggactacatgaggagacaaaagagacct
tcttcaggaacagtttttgatgatgctttctggctggagttgaattatctagaggttgcc
aaagtagctcagtcttgtgctgctcattttacagcattgctctatgcagaaatctatgca
gataagaagaacttggatgatcaagagaaaagagatgctcttgtgacaaacagaagtctt
acatttgaagaaggaagccaaaatacaactatttccagtttgagtgaaaaaagtaaggaa
gaaactgggataagtttacaggatctgcttttagaaatctacagaagtataggagagcca
gatagtctttatggctgtggtggagggaaaatgttacaaccccttactagactacgaaca
tatgaacatgaagcaatgtgggggaaggccttagtaacatatgaccttgagacaacaatc
tcctcatcaactcgtcaggcaggaataattcaggccttgcagaatttgggactctgccat
attctttccatctatttaagaggattagatcatgaaaataaagagtggtgtgctgaacta
caggaacttcattaccaagtagcatggaggaatatgcagtgggaccactgcatttctgtc
aacaaagaaatggaaagaaccagttaccacgagttgttgtacaatgctctgcaatctcta
agagacagagaattctccactttttatgaaagtctcaaacatgccagagttaaagaagtg
gaagagttgtgtaagggcagtcttgagtctgtgtattccctctaccctacacttagcaga
ttgcaggccattggagagcttgaaaacattggagaacttttctcaagatcggtaacagat
aggcagccctctgaagtgtacatgaagtggtggaaacattcccagcttctcaaagacagt
gattttagttttcaggagcctataatggccctacgcacagtcattttggagatcttgatg
gaaaaggaaatggaaaactcccaaagagagtgtttgaaggacattctcaccaagcatctc
gtagaactctctgtattagcccgaactttcaagaacacacagctccctgaaagggcaata
tttcaaattaaacagtataattcagctagtagtggagtctctgagtggcaactggaggag
gcacaagtattctgggcaaaaaaggaacagagtcttgccctgaatattctcaagcaaatg
atcaagaagctggatgccagttgtacagagaatgatcccaacttaaaacttatatataca
gaatgtctaagagtttgtggcacttggttagcagaaacttgcttagaaaatcctgcagtc
atcatgcagacctatctagaaaaggctgtggaagttgctgaaaattatgatggagaaagc
aatgatggcctgagaaatggaaaaatgaaggcatttctctcattagcacggttctcagat
actcaataccaaagaattgaaaactacatgaaatcctcagaatttgaaaataagcaagct
cttctgaaaagagccaaggaggaagttggcctacttagggaacataaaatccagaccaac
agatacacagtaaaggttcagcgagagctagagttggatgaatgtgcactccgtgcattg
aaagaggatcgtaaacgtttcttatgtaaagcagttgaaaattacatcaattgcttatta
agtggtgaagggcatgatatgtggatatttcgtctttgttctctctggcttgaaaattct
ggagtttctgaagtcaatggcatgatgaagagagatggaatgaagattccatcatacaaa
tttttgcctcttatgtaccaattggctgctagaatggggaccaagatgatgggaggtcta
ggatttcatgaagtcctcaataatctcatctctagaatttcaatggatcatcctcatcac
actttgtttatcatattggccttagcaaatgcaaacaaagatgaatttttgaccaaacca
gaggcagccagaaggagtagaattactaaaaatgcacctaaacaaagctctcagcttgat
gaggatcgaaccgaggctgctaacaaaataatacgtactatccgaagtaggagacctcag
atggtcagaagtgttgaggcactttgtgatgcttatattatactagcaaatttagatgcc
actcagtggaggactcagagaaaaggcataaatattccagcagaccagcccattatcaaa
cttaaaaatttagaagatgttgttgtccctactatggaaattaaggtggaccccacagga
gaatatggaaatctggtgactataaagtcatttaaagaacaatttcgtttagcaggaggt
ttaaatttaccaaaaataatagattgtgtgggctctgatggaaaggaaaggagacagctt
gtcaagggccgtgatgacctgagacaagatgccgtcatgcagcaggttttccagatgtgt
aatacattactacagagaaatactgaaaccaggaagaggaaattgactatttgtacttat
aaggtggttcccctttctcagcgaagtggtgttcttgaatggtgcacaggaactgtccct
attggtgaatttcttgttaacaatgagaatggtgctcataaaagatacaggccaaaggat
ttcagtgccattcactgccaaaagaaaatgatggatatgcagaaaaagtcttttgaagag
aaatatgaaactttcatggagatttgtcaaaattttcaaccagttttccgttacttctgc
atggaaaaattcctggatccagcagtgtggtttgagaaacggttggcttatactcggagt
gtggctacttcttctattgttggttacatacttggacttggtgatagacatgtacagaat
atcttgataaatgagcagtcagcagaacttgtacatatagatttaggagttgcttttgaa
cagggcaaaatccttcctactcctgaaacagttccttttagacttaccagagatattgtg
gatgggatgggcattactggtgttgaaggtgtcttcagaagatgctgtgagaaaaccatg
gaggtaatgagaaattctaaggaaaccctgttaaccattgtagaggtcctcctatatgat
cctctctttgactggaccatgaatcctttaaaagctttatatttacaacagaggccagac
gatgaaagtgagctccattccactccaaatgcagatgaccaggaatgcaaacgaaatctc
agtgatattgaccagagtttcaataaagtagctgaacgtgtcttgatgagactgcaagag
aaactaaaaggagtagaggaaggaaccgtgctcagtgttggtggacaggtgaatttgctc
atacagcaggccatggacccgaaaaatctcagccgacttttcccaggatggaaagcttgg
gtgtga

DBGET integrated database retrieval system